DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG6996

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:402 Identity:97/402 - (24%)
Similarity:154/402 - (38%) Gaps:99/402 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LECVDGIIVILTCPDGDYFNSTLNRCVEDTCGVCN--GNGTTCTDGELKVDPTNCAGYLACSNGN 160
            |..:.|:|:|.|......||:||         :|:  .|||...      ||..|..::.|.:|:
  Fly     5 LAFISGLIMIPTISGALTFNATL---------ICSLVVNGTKMN------DPRACNAWIQCIDGS 54

  Fly   161 WVSKQCADGAYFNAILETCVQDDEGICVN---CKEGSTKPLAD---CTMYEICSGGKYVTKSCDS 219
            .||..||.|.:::...:.|:......|::   |....|...||   |..|..|..||.....|::
  Fly    55 PVSGSCATGLFYDRESQKCLSSSSIKCLSSDPCAALPTGFAADPYSCNGYYYCKDGKGTHGVCNT 119

  Fly   220 GYYWNSQSEVCDVD---------NGQCNGNGTTCTDGELKVDPTNCAGYLACSNGNWVSKQCADG 275
            |..:||.::.|..|         :..||    ...||....|..||.||..|.:|..::..|...
  Fly   120 GMNFNSGTQDCIRDFPCSNKMDPDSYCN----ILPDGVFVKDTDNCNGYQLCWDGQVINGTCPGT 180

  Fly   276 AYFNVTLETCVQDDEGICVNCKEGSTKPLADCTMYEIC--SGGKYVT--KSCDSGYYWNSQSEVC 336
            .||..:...|   |....|.|   ...|:.|.:...:|  :|| :::  |:| :|||:      |
  Fly   181 FYFKASTAQC---DYPQNVEC---DFVPVPDISKKGVCPETGG-FISDNKTC-NGYYY------C 231

  Fly   337 -DVDNGQCNGNGTTCTDGELKVDPTNCAGYLACSNGNWVSKQCADGAY------FNATLETCVQD 394
             |:.||:.:.....|:||..         :||...|..|.:......|      .|:|::...:.
  Fly   232 KDLGNGEFSLEHGVCSDGRF---------FLATDGGACVPRSKVKCGYDRCVGLGNSTIQLANES 287

  Fly   395 DEGICVNCKEGSTKPLADCTMYEICSGG-----------KY---VTKSCDSGYYWNSQSEVCDVD 445
            |:|               |..|.||..|           :|   :|:.|.:.....:..::.:..
  Fly   288 DDG---------------CRGYSICQDGIVIGQGTCPQDEYFDEITQRCTTQVISYTACQISEAT 337

  Fly   446 NGQCNGNGTTCT 457
            .|....:|||.|
  Fly   338 TGSQVPSGTTTT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696 9/25 (36%)
CBM_14 145..184 CDD:279884 11/38 (29%)
CBM_14 251..290 CDD:279884 11/38 (29%)
CBM_14 357..396 CDD:279884 7/44 (16%)
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 14/49 (29%)
ChtBD2 85..130 CDD:214696 13/44 (30%)
CBM_14 146..196 CDD:279884 16/56 (29%)
CBM_14 273..322 CDD:279884 11/63 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.