DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and obst-J

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster


Alignment Length:286 Identity:66/286 - (23%)
Similarity:108/286 - (37%) Gaps:61/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIISLFMGSSSAVCCSEGDTKVDA--------------DDCTKYLICCHGE---FVSKSCASGSY 62
            |:|.|.:..::|:..:| .|.:.|              |.|.::.:|...:   |...:|.:..:
  Fly     6 LVIWLLLAIATALVKAE-LTDISAICRISDPWQMLPHKDHCQRFYVCTGDDDMPFQEFNCPAEYH 69

  Fly    63 WNSELNICVVDDGQCRPPTCVD--------GEITPNPDDCAGYLECVD-GIIVILTCPDGDYFNS 118
            ::.:|.|||       |..|.|        ..:.....||..|.:|:: |...:..|..|:||:.
  Fly    70 FSKKLMICV-------PGACTDESVFCGLTNSVERVQSDCTRYRQCLEGGSFAVAKCSVGNYFDP 127

  Fly   119 TLNRCVEDTCGVCNGNGTTCTDGELKVDPTNCAGYLACSNGNWVSKQCADGAYFNAILETCVQDD 183
            ....|:.......:.......|.....:|::|..|..|.:|.....||..|.||:..:.:||.|.
  Fly   128 ARRACLPVAISAAHQCSCVLPDNATLANPSDCETYFRCHSGQAELVQCPSGDYFDERVSSCVPDH 192

  Fly   184 EGICVNCKEGSTKP-------------------LA----DCTMYEICSGGKYVTKSCDSGYYWNS 225
            .|||:   |..|.|                   ||    ||..|.||:..:.:...|..|.|::.
  Fly   193 TGICL---EKPTMPPTLTEQALAMDECIRTGSRLAPHSRDCQRYYICAKKRVLEMRCPRGQYFDV 254

  Fly   226 QSEVCDVDNG-QCNGNGTTCTDGELK 250
            ....|.:|.| :|........|.||:
  Fly   255 VRRYCALDLGSECQALQAEKQDLELE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884 10/54 (19%)
ChtBD2 <89..124 CDD:214696 9/35 (26%)
CBM_14 145..184 CDD:279884 13/38 (34%)
CBM_14 251..290 CDD:279884 66/286 (23%)
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 9/45 (20%)
CBM_14 145..192 CDD:279884 13/46 (28%)
CBM_14 216..259 CDD:279884 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D29657at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.