DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and obst-H

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:309 Identity:71/309 - (22%)
Similarity:102/309 - (33%) Gaps:111/309 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 WVSKQCADGAYFNATLETCVQDDEGICVNCKEGSTKPLADCTMYEICSGGKYVTKSCDSGYYWNS 543
            |.|:..||  :|    :.|...|:|..|...|       .|..|..|.|.:.:...|:.|.|::|
  Fly    14 WSSRINAD--HF----DECDGMDDGAFVQSWE-------SCQSYVYCEGEESLKGDCEDGEYFDS 65

  Fly   544 QSEVCDVDNGQCNGNGTTCTENEVKVNPADCAGYLQCINGVFVARKCSATQFFNTTLKECEVDTE 608
            ::..||:      ....:|..:||. .|:|                           .|.|.|.|
  Fly    66 EAGTCDI------AANVSCFLDEVD-EPSD---------------------------PEPETDEE 96

  Fly   609 NVCIPKT-----------------------CDPDC--CDVPNNSIWPVEKN-CSAFYQCVNGNKY 647
            ...||.|                       ..|:|  .|.|...|:....| |:.:|.|.:|:..
  Fly    97 EEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNNSCTNYYLCYHGHAM 161

  Fly   648 EQRCSNNLQYNSIIEQCDYPENVQCDDGSAPPSGPIAGPSGTYCESHGRCVGQRDGTMFADASGD 712
            |..|.|.|.:||:..|||||:.|||         ....|....|..|        .|.|.....:
  Fly   162 EMHCDNELYFNSLTGQCDYPDKVQC---------AFEDPRSHKCLPH--------MTEFFPHPDN 209

  Fly   713 CSSNYVVCQCECEVNFTCSSGLL----------FNLQVKSCDWPDNVKC 751
            |  ||.         :.|..|.|          ::::.:||......||
  Fly   210 C--NYF---------YYCIKGFLTLQQCPFYYGWDIERRSCVQIGVAKC 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:279884
CBM_14 251..290 CDD:279884
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884 6/22 (27%)
CBM_14 563..610 CDD:279884 8/46 (17%)
CBM_14 621..670 CDD:279884 19/49 (39%)
CBM_14 697..749 CDD:279884 10/61 (16%)
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 15/63 (24%)
CBM_14 142..184 CDD:279884 16/41 (39%)
ChtBD2 203..240 CDD:214696 8/47 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I8249
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.