DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG5897

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:452 Identity:98/452 - (21%)
Similarity:143/452 - (31%) Gaps:181/452 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GVALCLIISL--------------------FMGSSSAVCCSEG---DTK-VDADDCTKYLI---- 46
            |..||:|:::                    ::|..|. |.:.|   |.| :|...||:.|:    
  Fly     7 GFHLCVILAIVAEIRGFSMEDKCKLWAGTGYIGDPSD-CQAWGYCQDNKLIDRRSCTEGLLYSFR 70

  Fly    47 ---C-------CHGEFVSKSCASGSYWNSELNICVVDDGQCRPPTCVDGEITPNPDDCAGYLECV 101
               |       ||.: :|:.|||...||                      ...||.||..:::|.
  Fly    71 DGTCKRASDTICHSQ-LSEICASLEPWN----------------------YVANPADCRRFVKCA 112

  Fly   102 D------GIIVILTCPDGDYFNSTLNRCVEDTCGVCNGNGTTCT---DGELKVDPTNCAGYLACS 157
            |      |     .|..|..|::....|:|:..|....|  .|:   ||....||.:|..|..|.
  Fly   113 DLDDPTWG-----DCGVGQVFSNKKQTCLEEVAGCPQDN--ICSHMKDGSFVGDPKSCQIYYKCH 170

  Fly   158 NGNWVSKQCADGAYFNA--------ILETCVQDDEGICVNCKEGSTKPLADCTMYEICSGGKYVT 214
            ||......|:.|.|||.        :...|.:|||...:      |.|..|   :.||       
  Fly   171 NGFGTMLNCSVGRYFNRKTGNCQSWMPHYCSKDDEDNIL------TPPSTD---HNIC------- 219

  Fly   215 KSCDSGYYWNSQSEVCDVDNGQCNGNGTTCTDGELKVDPTNCAGYLACSN----GNWVSKQCADG 275
                |.||...:..|                  :|..|...|.||.:|::    |.|.|  |..|
  Fly   220 ----SKYYQRDRDGV------------------QLLPDLMTCYGYYSCTSQFDVGKWSS--CPWG 260

  Fly   276 AYFNVTLETCVQDDEGICVNCKEGSTKPLADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDVDN 340
            .:|....:.|....:..|               .|:.|:.              .:|..|..::.
  Fly   261 LHFEWWSQRCGSPKDNSC---------------SYDRCAN--------------RNQLMVATINT 296

  Fly   341 GQCNGNGTTCTDGELKVDPTNCAGYLACSNGNWVSKQC-ADGAYFNATLETCVQD--DEGIC 399
            | |. ..|.|.|...|                 .|::| .|..|||..|..|..:  :..:|
  Fly   297 G-CR-EFTICQDNRSK-----------------SSQKCPEDYPYFNELLRQCTDEYPNHRVC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884 13/51 (25%)
ChtBD2 <89..124 CDD:214696 10/40 (25%)
CBM_14 145..184 CDD:279884 14/46 (30%)
CBM_14 251..290 CDD:279884 12/42 (29%)
CBM_14 357..396 CDD:279884 8/41 (20%)
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.