DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG33986

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:324 Identity:77/324 - (23%)
Similarity:106/324 - (32%) Gaps:108/324 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 NCAGYLACSNGNWVSKQCADGAYFNATLETCVQDDEGICVNCKEGS-TKPLADCTMYEIC-SGGK 529
            ||  .||.:...|...:..:..       |..|....||.|...|. .:...||.|:.:| ..|.
  Fly    12 NC--LLATAQLTWRPSKPTNSV-------TIRQSGSRICANHLVGEFVEHAEDCHMFYLCVENGD 67

  Fly   530 YVTKSCDSGYYWNSQSEVCD-VDNGQC-------------NGNGTTCTENEVKVNPADCAGYLQC 580
            .|..||.....:||:|.:|| ..|.:|             .|||.....|.|    .|.|.|   
  Fly    68 AVLASCPPTMLFNSESRLCDSATNVKCRNETDPIETPPFDGGNGDGDPNNMV----TDAATY--- 125

  Fly   581 INGVFVARKCSATQFFNTTLKECEVDTENVCIPKTCDPDCCDVPNNSIWPVEKNCSAFYQCVNGN 645
                     ||       ||.|.:..::.:..          |.::|      :|..:|.|..|.
  Fly   126 ---------CS-------TLVEQQQSSDRIVY----------VGSSS------SCRKYYICYYGQ 158

  Fly   646 KYEQRCSNNLQYNSIIEQCDYPENVQCDDG---SAPPSGPIAGPSGTYCESHGRCVGQRDGTMFA 707
            ...|.||:.|.:|::..:||.||..||..|   ..|.:|....|||              ||.. 
  Fly   159 AILQECSSQLHWNAMTGKCDIPERAQCTVGGQEDMPTNGNSGFPSG--------------GTAI- 208

  Fly   708 DASGDCSSNYVVCQC----------ECEVNFTCSSG----------LLFNLQVKSCDWPDNVKC 751
                  ||:.:.|..          .||....|..|          ..|::..|||.|....:|
  Fly   209 ------SSDLIHCPAYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSCQWSRTAQC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:279884
CBM_14 251..290 CDD:279884
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884 7/34 (21%)
CBM_14 563..610 CDD:279884 10/46 (22%)
CBM_14 621..670 CDD:279884 15/48 (31%)
CBM_14 697..749 CDD:279884 14/71 (20%)
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 16/50 (32%)
CBM_14 141..185 CDD:279884 15/59 (25%)
ChtBD2 213..261 CDD:214696 9/47 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.