DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG32302

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:396 Identity:90/396 - (22%)
Similarity:124/396 - (31%) Gaps:154/396 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VALCLI-ISLFMGSSSA-------------VCCSEGDTKVDADDCTKYLICCHGEFVSKSCASGS 61
            |.:||| ::|.:||:.|             ||.          :||....|...       |:||
  Fly     5 VPVCLILLALALGSAWANDNPCQDVRIPGFVCM----------NCTTLGYCIRD-------ATGS 52

  Fly    62 YW--------NSELNICVVDDG--------QCRPP-----TCVDGEITPNPDDCAGYLECVDGII 105
             |        .||.|....|:|        ||:.|     :|....:.|:|.||..|.||.|..:
  Fly    53 -WETISMLGCQSEYNFYCSDEGTFGCTFQSQCQVPKRGPFSCQQAGLFPDPYDCRRYHECSDQSV 116

  Fly   106 VILTCPDGDYFNSTLNRCVEDTCGVC-NGNGTTCTDGE--LKVDPTNC-AGYLACSNGNWVSKQC 166
                                ||..:| ||.|.:...|.  |..:...| .....||....|....
  Fly   117 --------------------DTPRICSNGAGYSTLTGTCVLPRESEQCIQEQFTCSRSGQVGGWA 161

  Fly   167 ADGAYFNAILETCVQDDEGICVNCKEGSTKPLADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCD 231
            .|..||.            :|||....|..||               ...|..|:.:||.|.|.|
  Fly   162 PDNRYFY------------VCVNDTANSLYPL---------------MMKCHEGFVFNSYSCVPD 199

  Fly   232 ---------VDNGQCNGNG-------------TTCTDGELKVDPTNCAGYLACSNGNWVSKQCAD 274
                     :::..|..|.             ..|.||||:|                  ..|..
  Fly   200 TRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEV------------------MTCPA 246

  Fly   275 GAYFNVTLETCVQDDEGIC-----VNCKEGSTKPLADCTMYEICSGGKYVTKSCDSGYYWNSQSE 334
            |...:..:.|||.|....|     ::|...|||     ..|.||...:....||..|.|:|:::.
  Fly   247 GFQIDPKILTCVTDRIYQCSDFEILSCPNVSTK-----DEYCICIDHQLQIYSCPMGQYFNAETR 306

  Fly   335 VCDVDN 340
            .|..::
  Fly   307 KCQSES 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884 10/45 (22%)
ChtBD2 <89..124 CDD:214696 8/34 (24%)
CBM_14 145..184 CDD:279884 7/39 (18%)
CBM_14 251..290 CDD:279884 7/38 (18%)
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 16/69 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444025
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.