DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG13806

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:283 Identity:69/283 - (24%)
Similarity:106/283 - (37%) Gaps:79/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 ICVNCKEGSTKPLADCTMYEICSGG--KYVTKSCD--SGYYWNSQSEVCDVDNGQCNGNGT---- 560
            ||.:|     :.||.|..:   |.|  ....:|||  :|||.|::...|..:.|.|:..|.    
  Fly    46 ICESC-----ELLATCVRH---SNGWVNIPVESCDVANGYYCNARLGSCTNETGPCHPFGIEGNF 102

  Fly   561 TCTENEVKVNPADCAGYLQC--INGVFVAR--KCSATQFFNTTLKECEVD-TENVCIPKTCDPDC 620
            .||...:..:|.||..|..|  :....||.  .|...:.|:.|..:|.:. |::||:.:  ...|
  Fly   103 QCTSQGIFPDPYDCQKYHMCYFVGATLVAAAVDCGNDKAFDATTGQCTLTLTDSVCLQR--QYYC 165

  Fly   621 CDVPNNSIWPVEKNCSAFYQCVNGNKYEQRCSNNLQYNSIIEQCDYPENVQCDDGSA-------- 677
            .:..:.:.||...|  .||.|      :...:.||....:|    ||...:|:||..        
  Fly   166 PNAGHVAAWPTNPN--IFYVC------KSTVNQNLNDTIVI----YPSLHRCNDGETFVDYVCRS 218

  Fly   678 -----PPSGP-----IAGPSG-------TYCESHGRCVGQRDGTMFADASGDCSSNYVVCQCECE 725
                 |||..     |..|:.       ..|:..|         :.||.: || ..|..|..   
  Fly   219 GSNVLPPSTDDPSVIIEDPNDDDFSVLPNTCQHVG---------LMADGN-DC-RKYYYCSA--- 269

  Fly   726 VNFT-----CSSGLLFNLQVKSC 743
            :|.|     |.:|..:..::.||
  Fly   270 LNGTLRHMDCPNGTYYRPELSSC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:279884
CBM_14 251..290 CDD:279884
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884 13/51 (25%)
CBM_14 621..670 CDD:279884 11/48 (23%)
CBM_14 697..749 CDD:279884 12/52 (23%)
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 13/52 (25%)
ChtBD2 247..293 CDD:214696 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443976
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.