DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and Peritrophin-A

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster


Alignment Length:136 Identity:36/136 - (26%)
Similarity:61/136 - (44%) Gaps:18/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 PDCCDVPNNSIWPVEKNCSAFYQCVNGNKYEQRCSNNLQYN---SIIEQCDYPENVQCDDGSAPP 679
            |:|.:......:...:||..|:.|.||....:.|.|.|.::   ::...|:|...|.|......|
  Fly    26 PECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRQWDP 90

  Fly   680 SGPIAGPSGTYCE-SHGRCVGQRDGTMFADASGDCSSNYVVCQCECEVNFTCSSGLLFNLQVKSC 743
            : ||:.|:   || ..|         ::| .|.|||:.|:.|.........|.:||.::.::..|
  Fly    91 T-PISTPA---CEYQFG---------LYA-VSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGC 141

  Fly   744 DWPDNV 749
            :|||.:
  Fly   142 NWPDQL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:279884
CBM_14 251..290 CDD:279884
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884 11/51 (22%)
CBM_14 697..749 CDD:279884 14/51 (27%)
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 12/46 (26%)
CBM_14 103..147 CDD:279884 15/53 (28%)
ChtBD2 179..218 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.