DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG34324

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:234 Identity:45/234 - (19%)
Similarity:62/234 - (26%) Gaps:82/234 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PPTCVDGEITPNPDDCAGYLECVDGIIVILTCP----------------DGDYFNSTLNRCVEDT 127
            ||.|......|.|..|           :..|||                .......|...|.. |
  Fly    75 PPPCTTTTCPPPPPPC-----------ITTTCPPPPPPPPPPPPPPCTRTPPPCTRTPPPCTR-T 127

  Fly   128 CGVCNGNGTTCTDGELKVDPTNCAGYLACSNGNWVSKQCADGAYFNAILETCVQDDEGICVNCKE 192
            ...|......||.     .|..|.....|:.....:..|.                         
  Fly   128 PPPCTRTPPPCTR-----TPPPCTRTPPCTTTPPCTPPCT------------------------- 162

  Fly   193 GSTKPLADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDVDN-----------GQCNGNGTTCTD 246
             :|||   ||. .:|:    ..||.::|...:...|..|:||           ..|.|.    .|
  Fly   163 -TTKP---CTT-TVCT----TPKSDNAGPIVDGNEEQPDIDNPVAIAQVLISRHDCRGQ----ED 214

  Fly   247 GELKVDPTNCAGYLACSNGNWVSKQCADGAYFNVTLETC 285
            |....|..:|..|..|:......:.|.:|.:|:..|:.|
  Fly   215 GTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKAC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696 7/50 (14%)
CBM_14 145..184 CDD:279884 4/38 (11%)
CBM_14 251..290 CDD:279884 9/35 (26%)
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.