DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and Mur2B

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:241 Identity:49/241 - (20%)
Similarity:79/241 - (32%) Gaps:61/241 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ITPNPDDCAGYLECVDGIIVILTCPDGDYFNSTLNRCVEDT--------CGVCNGNGTTCTDGEL 143
            |.|:||....|..|....::...|...:.||::..|||:..        ...|...|..      
  Fly    97 IKPHPDQQQYYYVCKPDCVIFSKCRGLESFNASSGRCVQHVPQHRPDHRPPQCQKEGRF------ 155

  Fly   144 KVDPTNCAGYLACSNGN---WVSKQCADGAYFNAILETCVQDDEGICVNCKEGSTKPLADCTMYE 205
             ..|.:|..|..|....   |:. .|..|..|:.:...|:..|:                |...|
  Fly   156 -PHPHDCKVYYRCDKNRTQPWLF-ACPAGTIFSPVERKCLPGDQ----------------CPSTE 202

  Fly   206 ICSGGKYVTKSCDSGYYWNSQSEVCDVDNGQCNGNGTTCTDGELKVDPTNCAGYLAC---SNGNW 267
            |...|.|:.::|:..:             .:|...||..:       ||:||.|..|   .:|.:
  Fly   203 ISDSGSYIPQNCELKF-------------PECAEEGTFRS-------PTDCALYYTCRLQESGTY 247

  Fly   268 VSK--QCADGAYFNVTLETCVQDDEGICVNCKEGSTK-PLADCTMY 310
            :..  :|.....|::..:.|....|..|.:...|..: |.|....|
  Fly   248 LQTRFKCPGSNSFDLERKLCRPRSEVDCFDFVPGPVQVPYAPQPYY 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696 9/34 (26%)
CBM_14 145..184 CDD:279884 9/41 (22%)
CBM_14 251..290 CDD:279884 10/43 (23%)
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 12/38 (32%)
CBM_14 150..197 CDD:279884 10/54 (19%)
CBM_14 221..275 CDD:279884 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.