DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and LOC108179232

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_021322084.1 Gene:LOC108179232 / 108179232 -ID:- Length:185 Species:Danio rerio


Alignment Length:175 Identity:49/175 - (28%)
Similarity:65/175 - (37%) Gaps:51/175 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SKS------CASGSYWNSELNICVVDDGQCRPP-TCVDGEITPNPDD------CAGYLECVDGII 105
            |||      |.:|.|.||  :..:...|.|.|. .|..|..|..|||      |.....|..|..
Zfish    28 SKSVSSCWLCPAGFYCNS--SGLIQPSGNCAPGFYCAGGAKTAMPDDGLTGNRCPTRYYCPQGCA 90

  Fly   106 VILTCPDGDYFNSTLNRCVEDTCGVCNGNGTTCTDGE-LKVDPTNCAGYLACSNGNWVSKQCADG 169
            ..|.||||.:.|||.:.    .|..| ..|..|.:|| |::          |..|::    |..|
Zfish    91 SPLHCPDGTHSNSTGSA----ECSDC-PTGWLCLEGEDLQL----------CPKGHY----CVGG 136

  Fly   170 AYFNAILETCVQDDEGICVNCKEGSTKPLADCTMYE---ICSGGK 211
            .         |:|    .:.|..|:..|.|..:..|   :||.|:
Zfish   137 T---------VED----ILPCPPGTYSPKAGQSQVEQCLLCSAGE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884 8/25 (32%)
ChtBD2 <89..124 CDD:214696 14/40 (35%)
CBM_14 145..184 CDD:279884 6/38 (16%)
CBM_14 251..290 CDD:279884
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
LOC108179232XP_021322084.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.