DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17826 and CG42728

DIOPT Version :9

Sequence 1:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001189111.1 Gene:CG42728 / 10178859 FlyBaseID:FBgn0261681 Length:156 Species:Drosophila melanogaster


Alignment Length:138 Identity:34/138 - (24%)
Similarity:54/138 - (39%) Gaps:24/138 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 CSGGKYVTKSCDSGYYWNSQSEVCDVDNGQCNG-NGTTCTDGELKVDPTNCAGYLACSN----GN 266
            |||        .:|:..|::|. |:.....|:| |...|||.      |.|.....||:    .|
  Fly    31 CSG--------QNGFINNTRSN-CNYSLINCSGQNSMFCTDN------TTCNANFTCSDILPVDN 80

  Fly   267 WVSKQCADGAYFNVTLETCVQDDEGICVNCKEGSTKPLA---DCTMYEICSGGKYVTKSCDSGYY 328
            ..:...:.......|..|.|...: |...|::|.||..:   :|..:..|..|..:.:.|..||.
  Fly    81 STALPISTTPNVVTTASTTVSPSD-IRRECRQGVTKRFSYPQNCNYFYYCVDGFLLVEQCPIGYA 144

  Fly   329 WNSQSEVC 336
            ::.|:..|
  Fly   145 FDPQTGAC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17826NP_648528.1 CBM_14 36..74 CDD:279884
ChtBD2 <89..124 CDD:214696
CBM_14 145..184 CDD:279884
CBM_14 251..290 CDD:279884 8/42 (19%)
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
CG42728NP_001189111.1 CBM_14 117..152 CDD:279884 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.