DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG42397

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:252 Identity:56/252 - (22%)
Similarity:80/252 - (31%) Gaps:109/252 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLWTVLL---LIGGLQTVVAQLTNVCQNQEDGTRLPLAT-----------------HCSRFVVCL 52
            ||:.:|:   ...|..|.:...|:.....||.|.:.:.|                 .|..:..||
  Fly    11 GLFALLVSGSTSSGEDTNIKLTTDESTTVEDTTEVLVTTLPPPVLCADEDLFLPAPDCREYYQCL 75

  Fly    53 KGEVSIIGSCPRGLHFNRELRECDFQWRANCLGLSAFAEVDDQCTCDCCAEECQDPIDDIDETTT 117
            .|| .|:..||.||:::|||                          :.||.:.|...||.:||||
  Fly    76 YGE-GILKICPDGLYWDREL--------------------------NVCAWDSQHCADDKNETTT 113

  Fly   118 AVTEDCDPDTTTSATEPSDSTEPTDATTDFDDPNNSSNTTPSSPSVVPSYCKSSRTDCVNQKTGT 182
            ..|.:|                              ::..|..| .:|.                
  Fly   114 PSTLNC------------------------------ASGLPFLP-YIPD---------------- 131

  Fly   183 YIDMPGICVRFIQCNNGCAEEFQCPSGLYFNTAIDDCDYWWNVDCTPTADGSTEIEG 239
                   |.:||||......:..||||||:|..:..|||        |.|.:.|..|
  Fly   132 -------CTKFIQCVYNIGFKLSCPSGLYWNQPLQSCDY--------TCDNAIEFSG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884 17/65 (26%)
CBM_14 175..226 CDD:279884 15/50 (30%)
CBM_14 251..296 CDD:279884
CBM_14 343..394 CDD:279884
CBM_14 420..471 CDD:279884
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 15/70 (21%)
ChtBD2 125..163 CDD:214696 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.