DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG13837

DIOPT Version :10

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster


Alignment Length:39 Identity:18/39 - (46%)
Similarity:24/39 - (61%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 GTYLKSTTNCSNYVVCQCECEVEMECADGLYWDESLQTC 464
            |.|:.|::|||.|:.|......|.||.||.|:||.|:.|
  Fly    34 GVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:426342
CBM_14 175..226 CDD:426342
CBM_14 251..296 CDD:426342
CBM_14 343..394 CDD:426342
CBM_14 420..471 CDD:426342 18/39 (46%)
CG13837NP_651113.1 CBM_14 36..81 CDD:426342 17/37 (46%)
CBM_14 154..203 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.