DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and Gasp

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster


Alignment Length:218 Identity:54/218 - (24%)
Similarity:85/218 - (38%) Gaps:54/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 CVRFIQCNNGCAEEFQCPSGLYFNTA-----IDDCDYWWNVDCTPTADGSTEIEGPSGTT-CSSQ 248
            |.::.:|:||.:|...|.:||.|:..     .::|||..||||    ...||:|.|..|. ||  
  Fly    36 CDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDC----GDRTELEPPITTPHCS-- 94

  Fly   249 GECAGKRDGYMIADPNSNGFFVCQCQCPIAMPCSEGLKFNETAQVCDW---IKDTKSAIGSSAVQ 310
                 :..|....:...:.|:.|....|....||.||.::..|:||.|   :.:.|:...::...
  Fly    95 -----RLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANGFS 154

  Fly   311 C--YGDLVYNATLDQCDYPENYVPKVECNTTSTVCQNQPEGELFPVEGKCNMFYKCNFNCAVEQY 373
            |  .|:|....:..:..:||:                            |..:|.|....|.|..
  Fly   155 CPAAGELANAGSFSRHAHPED----------------------------CRKYYICLEGVAREYG 191

  Fly   374 CPNNLVY----NPNTEECEYPQD 392
            ||...|:    :..|..||.|:|
  Fly   192 CPIGTVFKIGDSDGTGNCEDPED 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884 13/40 (33%)
CBM_14 251..296 CDD:279884 11/44 (25%)
CBM_14 343..394 CDD:279884 13/54 (24%)
CBM_14 420..471 CDD:279884
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 10/35 (29%)
CBM_14 97..144 CDD:366726 12/46 (26%)
CBM_14 170..218 CDD:366726 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.