DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG17147

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:345 Identity:79/345 - (22%)
Similarity:119/345 - (34%) Gaps:110/345 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KTGTYIDMPGICVRFIQCNNGCAEEFQCPSGLYFNTAIDDCDYWWNVDCTPTADGSTEIEGPSGT 243
            |.||.:..||.|.::|||.:|......|||...||.:...|     ||                 
  Fly    36 KNGTKVRKPGTCDQYIQCYDGNGTVLTCPSNQSFNPSKGSC-----VD----------------- 78

  Fly   244 TCSSQGECAGKR----DGYMIADPNS-NGFFVCQCQCPIAMPCSEGLKFNETAQ----------- 292
            |.::..:..|.|    ||..:|||.. :.:|.|....|:|..|..|..|:|.:|           
  Fly    79 TLANSNKYCGNRCEGLDGEWVADPTECHKYFYCMNGVPLAGMCPVGQHFDERSQSCLYGVDSMCV 143

  Fly   293 ----VCDWI-KDTKSAIGSSAVQCYGDLVYNATLDQCDYPENYVP-------------------- 332
                :|:.: ::||..........|          :||...|:..                    
  Fly   144 DVNNICELVAENTKFRNEKDCAYYY----------ECDKTGNHASKSCTVTSKKREYFDVESGNC 198

  Fly   333 ----KVECNTTS--TVCQNQPEGELFPVEGKCNMFYKCNFNCAVEQ------YCPNNLVYNPNTE 385
                ||||...|  .||.:.........:..|..::.|.....|..      .||....::.:.:
  Fly   199 VEANKVECTAHSKENVCTSSTTMTFKSDQATCRGYFVCKALYPVADLDPLWTQCPEGYFFDEDRQ 263

  Fly   386 ECEYPQDYVCPWEYTPPSGPNAGPSGIACESNGRCMGQREGTYL--KSTTNCSNYVVCQCECEV- 447
            .|                   |.|:.:.|..| ||.|:  ||.|  .|:.||.||:.|....|| 
  Fly   264 LC-------------------ANPTTVVCTHN-RCDGR--GTMLVTSSSNNCHNYIRCVDNKEVT 306

  Fly   448 EMECADGLYWDESLQTCNYK 467
            |..|....::||:::.|:.|
  Fly   307 EETCHWDHFFDETVEACSSK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884 16/46 (35%)
CBM_14 251..296 CDD:279884 17/64 (27%)
CBM_14 343..394 CDD:279884 7/56 (13%)
CBM_14 420..471 CDD:279884 19/51 (37%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 13/37 (35%)
ChtBD2 89..136 CDD:214696 15/46 (33%)
CBM_14 278..332 CDD:279884 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.