DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG17145

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:402 Identity:80/402 - (19%)
Similarity:138/402 - (34%) Gaps:103/402 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FGGLWTV--LLLIGGLQTVVAQLTNVCQNQEDGTRLPLATHCSRFVVCLKGEVSIIGSCPRGL-H 67
            ||.:..|  :||:.||..|..:..::|:...:.|.:.....||:.:.|: ..||...:|.... .
  Fly     4 FGAILGVALVLLLQGLDVVNGRNEDICRLFSNNTVIRDPESCSQSITCI-DSVSYYSTCTGSTPF 67

  Fly    68 FNRELRECDFQWRANCLGLSAFAEVDDQCTCDCCAEECQDPIDDIDETTTAVTEDC-------DP 125
            |:::..:|          :.:.:.....|:.. ||:..:..:.|        .:.|       |.
  Fly    68 FDKDTGKC----------VKSLSTSTSSCSIS-CADRAKQFVAD--------PKSCYGYYYCADE 113

  Fly   126 DTTTSATEPSDSTEPTDATTDFDDPNNSSNTTPSSPSVVPSYCKSSRTDCVNQKTGTYIDMPGIC 190
            :|....|.|.::  ..:|||......:.|:.|.|:    ..||..       .|.|...|....|
  Fly   114 ETALYGTCPQET--HFNATTQMCSRQHESDCTTST----FEYCSI-------VKNGVNFDNLQGC 165

  Fly   191 VRFIQCNNGCAEEFQCPSGLYFNTAIDDCDYWWNVDC----TPT---ADGSTEIEG---PSGTTC 245
            ..:..|..|..::..| |..|:..:..:|.....|||    .||   ...|...|.   ....||
  Fly   166 NMYHVCEKGVLKDKTC-SKTYYQASTGECVSKALVDCDAHPLPTDVCGKASKPYENKFVADEATC 229

  Fly   246 SSQGECAGKRDGYMIADPNSNGFFVCQCQCPIAMPCSEGLKFNETAQVCDWIKDTKSAIGSSAVQ 310
            .....||.::||  ..|||           |:...|.:...|:.::|:|         |..|:|.
  Fly   230 RGYFYCAKQKDG--TPDPN-----------PVWNQCPQDRFFDASSQMC---------ITPSSVY 272

  Fly   311 CYGDLVYNATLDQCDYPENYVPKVECNTTSTVCQNQPEGELFPVEGKCNMFYKCNFNCAVEQYCP 375
            |        :.|:||           ..|::...:..:|        |..:..|:....|.:...
  Fly   273 C--------SHDRCD-----------GRTASFVVSATKG--------CRNYLSCSDGVTVSERSC 310

  Fly   376 NNLVYNPNTEEC 387
            .|..::.....|
  Fly   311 GNYFFDDQQGAC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884 10/49 (20%)
CBM_14 175..226 CDD:279884 10/50 (20%)
CBM_14 251..296 CDD:279884 12/44 (27%)
CBM_14 343..394 CDD:279884 6/45 (13%)
CBM_14 420..471 CDD:279884
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 11/60 (18%)
CBM_14 278..327 CDD:279884 9/64 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444012
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.