DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG7017

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster


Alignment Length:377 Identity:74/377 - (19%)
Similarity:121/377 - (32%) Gaps:127/377 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 DCVNQKTGTYIDMPGICVRFIQC--NNGCAEEFQCPSGLYFNTAIDD----------CDYWWNVD 226
            |.:.|:|...  .|..|..:::|  |....|:..|.:||.:|..:..          |.|     
  Fly    34 DLLPQETSFL--RPNTCDNWVRCASNYSVLEQGGCAAGLNYNKELGRCILASSSAAVCPY----- 91

  Fly   227 CTPTADGSTEIEGPSGTTCSSQGECAGKRDGYMIADPNSN---GFFVCQCQCPIAMPCSEGLKFN 288
            ....||.:|.:             ||.:.:|..|.||:|:   |:.:|:..              
  Fly    92 ADSIADKATNL-------------CANETEGAFIVDPSSSDCRGYILCKSH-------------- 129

  Fly   289 ETAQVCDWIKDTKSAIGSSAVQCYGDLVYNATLDQCDYPENY-VPKVECNTTSTVCQNQPEGELF 352
                     |..|:       .|..:|:::.....|.|.:.| .|..:...||..|::.|.....
  Fly   130 ---------KQIKA-------NCPNELIFHPVSRSCVYEKQYRCPISQTKKTSPACRSLPNNTRL 178

  Fly   353 PVEGKCNMFYKCNFNCAVEQYCPNNLVYNPNTEEC------------------------------ 387
            .....|:.:|:|.......:.||....|:.|...|                              
  Fly   179 ADPVHCDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEVSCYESAALPEPENTFCLDSATGSA 243

  Fly   388 ---EYPQDYVCPWEY---TPPSGP-NAGPSGIAC---------------ESNGRCMGQR----EG 426
               .:..|..|...|   :|.:|. :..|..::|               ..|.||...|    ..
  Fly   244 RVGYFADDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFDFEKLSCRDRLNVRCQLDRCVGTNI 308

  Fly   427 TYLKSTTNCSNYVVCQCECEVEM-ECADGLYWDESLQTC---NYKNQVTCTL 474
            ||:....:|.:|..|.....|.: :|..|.|:||..|.|   ||.| :.|::
  Fly   309 TYVNVAGDCQSYGRCSGGVTVSLGQCPTGYYFDERNQGCTQTNYHN-IACSV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884 13/62 (21%)
CBM_14 251..296 CDD:279884 9/47 (19%)
CBM_14 343..394 CDD:279884 11/83 (13%)
CBM_14 420..471 CDD:279884 18/58 (31%)
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 15/81 (19%)
ChtBD2 246..290 CDD:214696 7/43 (16%)
CBM_14 303..348 CDD:279884 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.