DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and obst-H

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:291 Identity:71/291 - (24%)
Similarity:98/291 - (33%) Gaps:72/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CQNQEDGTRLPLATHCSRFVVCLKGEVSIIGSCPRGLHFNRELRECDFQWRANCLGLSAFAEVDD 94
            |...:||..:.....|..:|.| :||.|:.|.|..|.:|:.|...||.....:|.    ..||| 
  Fly    26 CDGMDDGAFVQSWESCQSYVYC-EGEESLKGDCEDGEYFDSEAGTCDIAANVSCF----LDEVD- 84

  Fly    95 QCTCDCCAEECQDPIDDIDETTTAVTEDCDPDTTTSATEPSDSTEPTDATTDFDDPNNSSNTTPS 159
                     |..||..:.||      |:.:...|...|||.....||:.    |..|.:....|:
  Fly    85 ---------EPSDPEPETDE------EEEEIPATPRPTEPPIVETPTEV----DIINIAPVVRPN 130

  Fly   160 SPSVVPSYCKSSRTDCVNQKTGTYIDMP--GICVRFIQCNNGCAEEFQCPSGLYFNTAIDDCDYW 222
            .|              ::...|..|.|.  ..|..:..|.:|.|.|..|.:.||||:....|||.
  Fly   131 CP--------------ISDDPGQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYP 181

  Fly   223 WNVDCTPTADGSTEIEGPSGTTCSSQGECAGKRDGYMIADPNSNGFFVCQCQCPIAMPCSEGLKF 287
            ..|.|.        .|.|....|.                |:...||.....|.....|.:|.. 
  Fly   182 DKVQCA--------FEDPRSHKCL----------------PHMTEFFPHPDNCNYFYYCIKGFL- 221

  Fly   288 NETAQVC----DWIKDTKSAIGSSAVQCYGD 314
              |.|.|    .|..:.:|.:.....:|||:
  Fly   222 --TLQQCPFYYGWDIERRSCVQIGVAKCYGN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884 16/48 (33%)
CBM_14 175..226 CDD:279884 16/52 (31%)
CBM_14 251..296 CDD:279884 9/48 (19%)
CBM_14 343..394 CDD:279884
CBM_14 420..471 CDD:279884
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 16/51 (31%)
CBM_14 142..184 CDD:279884 14/41 (34%)
ChtBD2 203..240 CDD:214696 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I8249
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.