DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG10154

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster


Alignment Length:368 Identity:79/368 - (21%)
Similarity:122/368 - (33%) Gaps:115/368 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NVCQNQEDGTRLPLATHCSRFVVCLKGEVSIIGSCPRGLHFNRELRECDFQWRANCLGLSAFAEV 92
            |||.|..||..||...:||:::.|....:..:||                     ||.|:.    
  Fly    56 NVCGNVADGVYLPYVGNCSKYIECENNTIKEVGS---------------------CLDLAK---- 95

  Fly    93 DDQCTCDCCAEECQDPIDDIDETTTAVTE-DCDPDTTTSATEPSDSTEPTDATTDFDDPNNSSNT 156
            |:...|| ..:.|:...|.:.:..|.:.| .|.|.                              
  Fly    96 DNPDICD-PNKSCELGYDPVLQVCTYMEEVQCLPT------------------------------ 129

  Fly   157 TPSSPSVVPSYCKSSRTD--CVNQKTGTYIDMPGICVRFIQCNNGCAEEFQCPSGLYFNTAIDDC 219
                       |:|.|..  |.:          ..|.:::.|..|.....||..||.:|.|.|.|
  Fly   130 -----------CESFRLSSFCYD----------NTCTKYVLCYYGKPVLRQCHDGLQYNNATDRC 173

  Fly   220 DYWWNVDCTPTADGSTEIEGPSGTTCSSQGECAGKRDGYMIADPNSNGFFVCQCQCPIAMPCSEG 284
            |:...|||... |.|...:........|:..|              :.::||....|....|:.|
  Fly   174 DFPEYVDCVAN-DCSATFQPEDIIYLGSKASC--------------SKYYVCSNGHPWEQQCAPG 223

  Fly   285 LKFNETAQVCDWIKDTKSAIGSSAVQCYGDLVYNAT-LDQCDYPENYVPKVECNTTSTVCQNQPE 348
            |.:|.:.:.||:.|:....|.:.|...   |.|:.| |.:.|        ::|....|       
  Fly   224 LAYNPSCKCCDFAKNVNCTIDAVARNI---LPYSRTPLRRAD--------IKCPLMGT------- 270

  Fly   349 GELFPVEGKCNMFYKCNFNCAVEQYCPNNLVYNPNTEECEYPQ 391
             ..||.:.:.:.:|.|.....|...|...|.|:|..|:|..|:
  Fly   271 -HFFPHKSRRDAYYYCVEGRGVTLDCTPGLYYDPKVEDCRRPE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884 11/48 (23%)
CBM_14 175..226 CDD:279884 13/50 (26%)
CBM_14 251..296 CDD:279884 9/44 (20%)
CBM_14 343..394 CDD:279884 12/49 (24%)
CBM_14 420..471 CDD:279884
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 16/59 (27%)
CBM_14 197..239 CDD:279884 12/55 (22%)
ChtBD2 263..311 CDD:214696 13/55 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444016
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.