DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and obst-G

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster


Alignment Length:398 Identity:80/398 - (20%)
Similarity:125/398 - (31%) Gaps:153/398 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FGGLWTVLLL----IGGLQTVVAQLTNVCQNQEDGTRLPLATHCSRFVVCLKGEVSIIGSCPRGL 66
            ||.|..:|:|    :..:|...|..|::|:.:..|. ||:...|..:.||..|. ::.|:|.:..
  Fly     4 FGLLCVMLVLQESTLAVVQNGFAFKTSLCEGKNGGL-LPMFGSCKGYYVCADGN-AVTGTCEKNT 66

  Fly    67 HFNRELRECDFQWRANCLGLSAFAEVDDQCTCDCCAEECQDPIDDIDETTTAVTEDCDPDTTTSA 131
            .||.....|                 ||....||..:...:.:||                 ||:
  Fly    67 LFNPLTLHC-----------------DDPDNVDCIFDGKDNIVDD-----------------TSS 97

  Fly   132 TEPSDSTEPTDATTDFDDPNNSSNTTPSSPSVVPSYCKSSRTDCVNQKTGTYIDMPGICVRFIQC 196
            :|           :|.||....:.|.|      |...|:::.                       
  Fly    98 SE-----------SDEDDDEEMAKTDP------PVTVKATKK----------------------- 122

  Fly   197 NNGCAEEFQCPSGLYFNTAIDDCDYWWNVDCTPTADGSTEIEGPSGTTCSSQGECAGKRDGYMIA 261
                                                       |..||....  ||||:||.|: 
  Fly   123 -------------------------------------------PRPTTLDKM--CAGKKDGVML- 141

  Fly   262 DPNSNG----FFVCQCQCPIAMPCSEGLKFNETAQVCDWIKDTKSAIGSSAVQCYGDLVYNATLD 322
              ..||    ::||:.:.|....|.:...|:.|.::|         :.:|..:|.|....|   .
  Fly   142 --TKNGSCQEYYVCKAKKPHLRSCPDKQHFSPTRRIC---------MKASEAKCSGGTREN---K 192

  Fly   323 QCDYPENYVPKVECNTTSTVCQNQPEGELFPVEGKCNMFYKCNFNCAVEQYCPNNLVYNPNTEEC 387
            :.|.|.         ||..||.::.|..|......|..|..|:....:...||..|.:|..|..|
  Fly   193 ESDGPA---------TTGGVCSDEKENSLVAHRSDCGKFMLCSNMMFLVMDCPTGLHFNIATSRC 248

  Fly   388 EYPQDYVC 395
            :||:...|
  Fly   249 DYPKIAKC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884 13/48 (27%)
CBM_14 175..226 CDD:279884 0/50 (0%)
CBM_14 251..296 CDD:279884 16/48 (33%)
CBM_14 343..394 CDD:279884 14/50 (28%)
CBM_14 420..471 CDD:279884
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 15/69 (22%)
CBM_14 132..184 CDD:279884 17/63 (27%)
CBM_14 204..256 CDD:279884 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.