DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG5883

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:374 Identity:70/374 - (18%)
Similarity:111/374 - (29%) Gaps:137/374 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SVVPSYCKSSRTDCVNQKTGTYIDMPGICVRFIQCNNGCAEEFQCPSGL-------YFNTAIDDC 219
            |:...|..::...|...|.||.:..||.|...|.|.|     |:...|:       |::.:...|
  Fly    22 SIQTRYLNATDDICRLFKDGTQLLKPGSCSESIICQN-----FESTPGITCSGSKPYYSKSKGSC 81

  Fly   220 DYWWNVDCTPTADGSTEIEGPSGTTCSSQGECAGKRDGYMIADPNSNGFFVCQCQCPIAM-PCSE 283
                              :..:.|.|.:...|.|...||:....|...::.|.....:.. .|:.
  Fly    82 ------------------QASADTYCDTSKICKGSGTGYIGDTINCANWYYCDADALLGKGTCNL 128

  Fly   284 GLKFNETAQVCDWIKDTKSAIGSSAVQCYGDLVYNATLDQCDYPENYVPKVECNTTSTVCQNQPE 348
            |:.|::.::.|.:.:||                                  .|.....:|...|.
  Fly   129 GMYFDQVSKSCVYSEDT----------------------------------VCAAKYEICDVAPV 159

  Fly   349 GELFPVEGKCNMFYKCNFNCAVEQYCPNNLVYNPNTEECEYPQDYVCPWEYTPP----------- 402
            |..|..:..|:.:|.|:....||..|.|.|.||..|..|...:|.:|.....|.           
  Fly   160 GTPFRDDANCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICENHPLPDEVCGNKKLAVR 224

  Fly   403 --------------------SG-PNAGPSGIACESNG--------------------RCMGQREG 426
                                || |:..|....|:.|.                    ||.|:::|
  Fly   225 NKFVSDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQACMPRESQKCDYDRCDGRKDG 289

  Fly   427 TYLKSTTNCSNYVVCQCECEVEMECADG----------LYWDESLQTCN 465
            ..:.....|.:|:          ||.||          .|:|...|.|:
  Fly   290 FEVAEIDGCHHYI----------ECVDGRETTPISCEDKYFDVVTQNCS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884 14/57 (25%)
CBM_14 251..296 CDD:279884 10/45 (22%)
CBM_14 343..394 CDD:279884 17/50 (34%)
CBM_14 420..471 CDD:279884 13/56 (23%)
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 12/84 (14%)
CBM_14 154..204 CDD:279884 16/49 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.