DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG5897

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:383 Identity:73/383 - (19%)
Similarity:108/383 - (28%) Gaps:138/383 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AQLTNVCQNQEDGTRLPLATHCSRFVVCLKGEVSIIGSCPRGLHFNRELRECDFQWRANCLGLSA 88
            :||:.:|.:.|....:.....|.|||.|...:....|.|..|..|:.:.:.|             
  Fly    84 SQLSEICASLEPWNYVANPADCRRFVKCADLDDPTWGDCGVGQVFSNKKQTC------------- 135

  Fly    89 FAEVDDQCTCDCCAEECQDPIDDIDETTTAVTEDCDPDTTTSATEPSDSTEPTDATTDFDDPNNS 153
               :::...|         |.|:|                                         
  Fly   136 ---LEEVAGC---------PQDNI----------------------------------------- 147

  Fly   154 SNTTPSSPSVVPSYCKSSRTDCVNQKTGTYIDMPGICVRFIQCNNGCAEEFQCPSGLYFNTAIDD 218
                                 |.:.|.|:::..|..|..:.:|:||......|..|.|||....:
  Fly   148 ---------------------CSHMKDGSFVGDPKSCQIYYKCHNGFGTMLNCSVGRYFNRKTGN 191

  Fly   219 CDYWWNVDCTPTADGSTEIEGPSGT---TCSSQGECAGKRDGYMIADP--NSNGFFVCQCQCPIA 278
            |..|....|  :.|....|..|..|   .||...:  ..|||..:...  ...|::.|..|..:.
  Fly   192 CQSWMPHYC--SKDDEDNILTPPSTDHNICSKYYQ--RDRDGVQLLPDLMTCYGYYSCTSQFDVG 252

  Fly   279 --MPCSEGLKFNETAQVCDWIKDTKSAIGSSAVQCYGDLVYNATLDQCDYPENYVPKVECNTTST 341
              ..|..||.|...:|.|...||                      :.|.|..             
  Fly   253 KWSSCPWGLHFEWWSQRCGSPKD----------------------NSCSYDR------------- 282

  Fly   342 VCQNQPEGELFPVEGKCNMFYKCNFN-CAVEQYCPNNLVY-NPNTEEC--EYPQDYVC 395
             |.|:.:..:..:...|..|..|..| ....|.||.:..| |....:|  |||...||
  Fly   283 -CANRNQLMVATINTGCREFTICQDNRSKSSQKCPEDYPYFNELLRQCTDEYPNHRVC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884 12/48 (25%)
CBM_14 175..226 CDD:279884 15/50 (30%)
CBM_14 251..296 CDD:279884 12/48 (25%)
CBM_14 343..394 CDD:279884 15/54 (28%)
CBM_14 420..471 CDD:279884
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 14/107 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.