DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG33985

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster


Alignment Length:339 Identity:75/339 - (22%)
Similarity:120/339 - (35%) Gaps:100/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDFGGLWTVLLLIGGLQTVVAQLTNVCQNQEDGTRLPLAT---HCSRFVVCLKGEVSIIGSCPRG 65
            :.||.:...||.   |.|..|.:.:.|   .||..|...|   .|:.::.| .|:.|..|.|..|
  Fly     5 LKFGSILVSLLF---LATSHADVFDEC---NDGNNLSFVTSPKSCAHYIFC-NGDESYDGECEDG 62

  Fly    66 LHFNRELRECDFQWRANCLGLSAFAEVDDQCTCDCCAEECQDPIDDID----------ETTTAVT 120
            .:|::::..|                               :|:.|||          .||.:.:
  Fly    63 EYFSQDMEMC-------------------------------EPMGDIDCRTGSEVQRENTTDSSS 96

  Fly   121 EDCDPDTTTSATEPSDSTEPTDATTDFDDPNNS--SNTTPSSPS---VVPSYCKSSRTDCVNQKT 180
            .:...:::|.:|....:..|:...|.....|.|  |:||..||:   :|.:.|  .:.|  ||..
  Fly    97 TEITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPAIEIIVTNVC--PQLD--NQSR 157

  Fly   181 GTYIDMPGICVRFIQCNNGCAEEFQCPSGLYFNTAIDDCDYWWNVDCTPTADGSTEIEGPSGTTC 245
            ...:.....|..:..|..|.|....|.:.|:||:....||:..||.|.             ..|.
  Fly   158 IALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKCDHPENVRCL-------------AMTY 209

  Fly   246 SSQGECAGKR---DGYMIADPNSNGFFVCQC------QCPIAMPCSEGLKFNETAQVCDWIKDTK 301
            :.:.:|  ||   |.|..:| |.|.|:.|:.      |||.               ...|..:.:
  Fly   210 NPREQC--KRHVIDVYPHSD-NCNYFYQCRSGYLMVQQCPF---------------FYGWDYEKR 256

  Fly   302 SAIGSSAVQCYGDL 315
            |.:.....:||..|
  Fly   257 SCVALGQAKCYNKL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884 14/51 (27%)
CBM_14 175..226 CDD:279884 13/50 (26%)
CBM_14 251..296 CDD:279884 13/53 (25%)
CBM_14 343..394 CDD:279884
CBM_14 420..471 CDD:279884
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 14/80 (18%)
CBM_14 160..202 CDD:279884 10/41 (24%)
ChtBD2 215..259 CDD:214696 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.