DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG32302

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:313 Identity:68/313 - (21%)
Similarity:112/313 - (35%) Gaps:102/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 SNTTPSSPSVVPSY-CKSSRT--DCVNQKTGTY--IDMPGICVRF-IQCNN----GCAEEFQC-- 206
            :|..|.....:|.: |.:..|  .|:...||::  |.|.|....: ..|::    ||..:.||  
  Fly    21 ANDNPCQDVRIPGFVCMNCTTLGYCIRDATGSWETISMLGCQSEYNFYCSDEGTFGCTFQSQCQV 85

  Fly   207 ---------PSGLYFNTAIDDCDYW-----WNVD----CTPTADGSTEIEGPSGT---------- 243
                     .:||:.:..  ||..:     .:||    |:..|..||    .:||          
  Fly    86 PKRGPFSCQQAGLFPDPY--DCRRYHECSDQSVDTPRICSNGAGYST----LTGTCVLPRESEQC 144

  Fly   244 -----TCSSQGECAGKRDGYMIADPNSNGFFVC-----QCQCPIAMPCSEGLKFNETAQVCDWIK 298
                 |||..|:..|..       |::..|:||     ....|:.|.|.||..||..:  |  :.
  Fly   145 IQEQFTCSRSGQVGGWA-------PDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYS--C--VP 198

  Fly   299 DTKSAIGSSAVQ---CYGDLVYNATLDQCDYPENYVPKVECNTTSTVCQNQPEGELFPVEGK--- 357
            ||:|.....|::   |..:..|     ||.:..:.:...:|..........|.|  |.::.|   
  Fly   199 DTRSMRSIQAMESHTCMNNDRY-----QCPFRTSEIEYCKCVDGELEVMTCPAG--FQIDPKILT 256

  Fly   358 C--NMFYKCN----FNC----AVEQY------------CPNNLVYNPNTEECE 388
            |  :..|:|:    .:|    ..::|            ||....:|..|.:|:
  Fly   257 CVTDRIYQCSDFEILSCPNVSTKDEYCICIDHQLQIYSCPMGQYFNAETRKCQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884 15/73 (21%)
CBM_14 251..296 CDD:279884 13/49 (27%)
CBM_14 343..394 CDD:279884 14/71 (20%)
CBM_14 420..471 CDD:279884
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.