DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and obst-E

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:222 Identity:55/222 - (24%)
Similarity:82/222 - (36%) Gaps:51/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 CVRFIQCNNGCAEEFQCPSGLYFN---TAIDDCDYWWNVDCTPTADGSTEIEGPSGTTCSSQGEC 251
            |..:.:|.:|...|..||.||.|:   .|..:|.|.....|...|    .::..:||.     ||
  Fly    38 CDSYTECQDGTPVEKLCPDGLLFHQRTK
ATGECTYAPYSTCKERA----RLQPANGTE-----EC 93

  Fly   252 AGKRDGYMIADPNSNGFFVCQCQCPIA--MPCSEGLKFNETAQVCDWIKDTKSAIGSSAVQCYGD 314
            ..:...|...|....|.: ..|...:|  ..|.|||.|||....|||    ...:.|...:.|  
  Fly    94 PRQFGFYPNGDATKCGVY-RNCAHGVASLTKCPEGLAFNEETYQCDW----PDLVESCNAEAY-- 151

  Fly   315 LVYNA-TLDQCDYPENYVPKVECNTTSTVCQNQPEGEL--FPVEGKCNMFYKC------NFNCAV 370
            |.:|. ..|..|           ::.:......|||||  :.....|..::.|      .:||. 
  Fly   152 LGFNCPAADSAD-----------DSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCG- 204

  Fly   371 EQYCPNNLVYNPNTEECEY----PQDY 393
             :|    |.:|..|:.|::    |:.|
  Fly   205 -KY----LAFNSQTKLCDFYNKVPECY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884 12/38 (32%)
CBM_14 251..296 CDD:279884 14/46 (30%)
CBM_14 343..394 CDD:279884 16/63 (25%)
CBM_14 420..471 CDD:279884
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 9/26 (35%)
CBM_14 95..146 CDD:307643 15/55 (27%)
CBM_14 180..225 CDD:307643 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CXJD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.