DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and Peritrophin-A

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster


Alignment Length:232 Identity:57/232 - (24%)
Similarity:82/232 - (35%) Gaps:58/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 CVRFIQCNNGCAEEFQCPSGLYFN---TAIDDCDYWWNVDCTPTADGSTEIEGPSGTTCSSQGEC 251
            |.:|..|.||......|.:||.|:   ...:.|:|.|.|||.......|.|..|:         |
  Fly    43 CDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDC
KGRQWDPTPISTPA---------C 98

  Fly   252 AGKRDGYMIADPNSNGFFVCQCQCPIAMPCSEGLKFNETAQVCDWIKDTKSAIGSSAVQCYGDLV 316
            ..:...|.::...|..:..|....|....|..||.::|....|:|                    
  Fly    99 EYQFGLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNW-------------------- 143

  Fly   317 YNATLDQCDYPENYV-----PKVECNTTSTVCQNQPEGELFPVEGKCNMFYKCNFNCAVEQY--- 373
            .:..|:.|: ||..|     .||:.|:.:......|.   |||.|.|:....|     ||.:   
  Fly   144 PDQLLEHCN-PEAVVGFKCPTKVDPNSVAARFWPFPR---FPVAGDCHRLITC-----VEGHPRL 199

  Fly   374 --CPNNLVYNPNTEECEYPQDYVCPWEYTPPSGPNAG 408
              |..:.|::.:|..||.|       ||...|..|.|
  Fly   200 ISCGEDKVFDEHTLTCEDP-------EYASGSCANYG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884 12/38 (32%)
CBM_14 251..296 CDD:279884 10/44 (23%)
CBM_14 343..394 CDD:279884 15/55 (27%)
CBM_14 420..471 CDD:279884
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 13/39 (33%)
CBM_14 103..147 CDD:279884 10/63 (16%)
ChtBD2 179..218 CDD:214696 13/46 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.