DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and obst-A

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster


Alignment Length:261 Identity:66/261 - (25%)
Similarity:100/261 - (38%) Gaps:76/261 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SVVPSYCKSSRTDCVN----QKTGTYIDMPGICVRFIQCNNGCAEEFQCPSGLYF---NTAIDDC 219
            ::..:.|.::.....|    :..|.:.|... |.:|..|::|.|:...||.||.|   |...:.|
  Fly     7 AIAVTLCVATTVSAANFECPKPNGQFADEVQ-CDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKC 70

  Fly   220 DYWWNVDCTPTADGSTEIEGPSGTTCSSQGECAGKRDGYMIADPNSNGFF------VCQC--QC- 275
            |..:||||    :..||::.|     .|...|           |..||||      ||..  .| 
  Fly    71 DQPFNVDC----EDRTELQEP-----KSSKYC-----------PRKNGFFAHPDPAVCNIFYNCI 115

  Fly   276 ---PIAMPCSEGLKFNETAQVCDWIKDTKSAIGSSAVQCYGDLVYNATLDQCDYPENYVPKVECN 337
               .:...|:.||.|:|.:..|.| .||                  |..:.|:      |:...:
  Fly   116 EGDALETKCTVGLHFDEYSGTCVW-PDT------------------AKREGCN------PEQRTS 155

  Fly   338 TTSTVC-QNQPE----GEL-----FPVEGKCNMFYKC-NFNCAVEQYCPNNLVYNPNTEECEYPQ 391
            .|..|| ::||:    |::     :|....|..||.| |.....:..|....|||..||.|:.|:
  Fly   156 ETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDATEMCDAPE 220

  Fly   392 D 392
            :
  Fly   221 N 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884 17/57 (30%)
CBM_14 251..296 CDD:279884 15/56 (27%)
CBM_14 343..394 CDD:279884 18/61 (30%)
CBM_14 420..471 CDD:279884
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 16/50 (32%)
CBM_14 95..143 CDD:366726 16/66 (24%)
CBM_14 180..225 CDD:366726 14/42 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.