DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and Mur2B

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:214 Identity:48/214 - (22%)
Similarity:82/214 - (38%) Gaps:54/214 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 FFVCQCQCPIAMPCSEGLKFNETAQVCDWIKDTKSAIGSSAVQCYGDLVYNATLDQCDYPENYVP 332
            ::||:..|.|...| .||:                             .:||:..:|   ..:||
  Fly   107 YYVCKPDCVIFSKC-RGLE-----------------------------SFNASSGRC---VQHVP 138

  Fly   333 KVECNTTSTVCQNQPEGELFPVEGKCNMFYKCNFNCAVEQY---CPNNLVYNPNTEECEYPQDYV 394
            :...:.....||.  ||. ||....|.::|:|:.| ..:.:   ||...:::|...:| .|.|. 
  Fly   139 QHRPDHRPPQCQK--EGR-FPHPHDCKVYYRCDKN-RTQPWLFACPAGTIFSPVERKC-LPGDQ- 197

  Fly   395 CPWEYTPPSGPNAGPSGIACESN-GRCMGQREGTYLKSTTNCSNYVVCQCE-----CEVEMECAD 453
            ||......||.....:   ||.. ..|  ..|||: :|.|:|:.|..|:.:     .:...:|..
  Fly   198 CPSTEISDSGSYIPQN---CELKFPEC--AEEGTF-RSPTDCALYYTCRLQESGTYLQTRFKCPG 256

  Fly   454 GLYWDESLQTCNYKNQVTC 472
            ...:|...:.|..:::|.|
  Fly   257 SNSFDLERKLCRPRSEVDC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884
CBM_14 175..226 CDD:279884
CBM_14 251..296 CDD:279884 7/27 (26%)
CBM_14 343..394 CDD:279884 16/53 (30%)
CBM_14 420..471 CDD:279884 12/55 (22%)
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 10/61 (16%)
CBM_14 150..197 CDD:279884 14/51 (27%)
CBM_14 221..275 CDD:279884 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.