DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and cpg-1

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001021159.1 Gene:cpg-1 / 175586 WormBaseID:WBGene00000465 Length:584 Species:Caenorhabditis elegans


Alignment Length:409 Identity:108/409 - (26%)
Similarity:152/409 - (37%) Gaps:93/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CQNQEDGTRLPLATHCS-RFVVCLKGEVSIIGSCPRGLHFNRELRECDFQWRA-NCLGLSAFAEV 92
            |..:|||  |.....|| :|:.| .|.:|.|..||..|.::..:..|::.:.. .|.|:.  .:|
 Worm    61 CSTKEDG--LYAIGGCSPQFLTC-SGGISRIMDCPADLIYDPRIVACEYSYNVPQCGGVP--QDV 120

  Fly    93 DDQCTCDCCAEECQDPIDDIDETTTAVTED--CDPDTTTSATEPSDSTEPTDATTDFDDPNNSSN 155
            ..........|...:|...::|.||...||  ...:|||.|..|.|....|....|...|..:: 
 Worm   121 TSTQEAYPSEETTVNPYAPVEEATTTPAEDVTVPEETTTEAYAPVDDYSTTTPAEDVPVPVETT- 184

  Fly   156 TTPSSPSVVPSYCKSSRTD-----------CVNQKTGTYIDMPGICV-RFIQCNNGCAEEFQCPS 208
            .:|.:| :||....:...|           ||.:..|.|  ..|.|. .:..|:||.....|||:
 Worm   185 ASPYAP-IVPYTTGAPAADEPVTRSAVTKSCVGKADGFY--SFGECSDHYTACSNGYLIPMQCPA 246

  Fly   209 GLYFNTAIDDCDYWWNV-DCTPTADGSTEIEGPSG-TTCSSQGECAGKRDGYMIADPNSNGFFVC 271
            .|.|:.|...|||..|| :||   :||...||.:. ||..|.||                     
 Worm   247 RLAFDEARVICDYVMNVPECT---NGSGNDEGSADETTPESSGE--------------------- 287

  Fly   272 QCQCPIAMPCSEGLKFNETAQVCDWIKDTK---SAIGSSAVQCY------GDLVYNATLD-QCDY 326
                   ||.|.|..:.||..|.:.:..||   ..|.::.|..|      .:.|...|:. :.:.
 Worm   288 -------MPYSNGYGYEETTTVAEDVPSTKDYAEPIAAAYVARYPSEKTTAENVPTTTIGYEPEV 345

  Fly   327 PENYVPKVECNTTSTVCQNQPEGELFPVEGK---CNMFYKCNFNCAVEQYCP------------- 375
            .|...|.|| .||:|| ..:||.|....|.:   ..:.|:...   ||...|             
 Worm   346 VETTAPYVE-ETTTTV-GYKPEVEETTTEAEVPTTTVGYEPEI---VETTAPYVEETTTAADVPS 405

  Fly   376 NNLVYNP----NTEECEYP 390
            ...||.|    .|.|.|.|
 Worm   406 TTAVYEPEVVETTTEAEVP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884 16/49 (33%)
CBM_14 175..226 CDD:279884 20/52 (38%)
CBM_14 251..296 CDD:279884 7/44 (16%)
CBM_14 343..394 CDD:279884 15/68 (22%)
CBM_14 420..471 CDD:279884
cpg-1NP_001021159.1 CBM_14 61..113 CDD:279884 16/54 (30%)
CBM_14 214..266 CDD:279884 20/53 (38%)
CBM_14 <537..576 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.