DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7252 and CG43294

DIOPT Version :9

Sequence 1:NP_648527.1 Gene:CG7252 / 39353 FlyBaseID:FBgn0036226 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001356903.1 Gene:CG43294 / 12798218 FlyBaseID:FBgn0262986 Length:143 Species:Drosophila melanogaster


Alignment Length:188 Identity:38/188 - (20%)
Similarity:57/188 - (30%) Gaps:79/188 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RLPLATHCSRFVVCLKGEVSIIGSCPRGLHFNRELRECDFQWRANCLGLSAFAEVDDQCTCDCCA 102
            |.|....|.|:.     |..:: .||...::|.:|.:|:.|....|..:                
  Fly    26 RWPFPNDCHRYY-----ETRLL-DCPPEFYWNSQLLQCNSQTPVGCSSI---------------- 68

  Fly   103 EECQDPIDDIDETTTAVTEDCDPDTTTSATEPSDSTEPTDATTDFDDPNNSSNTTPSSPSV-VPS 166
                |||                                         .|.:|:.|:||.: .|.
  Fly    69 ----DPI-----------------------------------------TNWNNSYPNSPPIKEPE 88

  Fly   167 YCKSSRTDCVNQKTGTYIDMPGICVRFIQCNN----GCAEEFQCPSGLYFNTAIDDCD 220
              .|..|.....|....|..|..|.:||:|:.    .|     ||..||:|:.:..||
  Fly    89 --NSDLTKLCENKLNQLIPYPADCTKFIRCDYLPFVMC-----CPQYLYWNSQLLTCD 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7252NP_648527.1 CBM_14 30..79 CDD:279884 10/40 (25%)
CBM_14 175..226 CDD:279884 15/50 (30%)
CBM_14 251..296 CDD:279884
CBM_14 343..394 CDD:279884
CBM_14 420..471 CDD:279884
CG43294NP_001356903.1 CBM_14 96..139 CDD:307643 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.