DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7252 and LOC102554611

DIOPT Version :9

Sequence 1:	NP_648527.1	Gene:	CG7252 / 39353	FlyBaseID:	FBgn0036226	Length:	474	Species:	Drosophila melanogaster
Sequence 2:	XP_017455397.1	Gene:	LOC102554611 / 102554611	RGDID:	7689627	Length:	637	Species:	Rattus norvegicus

Alignment Length:	49	Identity:	11/49 - (22%)
Similarity:	19/49 - (38%)	Gaps:	10/49 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   397 WEYTPPSGPNAGPSGIACESN------GRCMGQRE----GTYLKSTTNC 435
            |::.|...|:..|.|...|.|      ...:.|..    |...|::::|
  Rat   394 WQFAPGYTPSISPLGFQPELNRAITALASALSQARVSPVGASRKASSHC 442

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7252	NP_648527.1	CBM_14	30..79	CDD:279884
		CBM_14	175..226	CDD:279884
		CBM_14	251..296	CDD:279884
		CBM_14	343..394	CDD:279884
		CBM_14	420..471	CDD:279884	4/20 (20%)
LOC102554611	XP_017455397.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D487374at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010