DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and megf11

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_009291879.1 Gene:megf11 / 563468 ZFINID:ZDB-GENE-060503-252 Length:1114 Species:Danio rerio


Alignment Length:377 Identity:86/377 - (22%)
Similarity:114/377 - (30%) Gaps:123/377 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CRLFKDGTQLLKPGSCSESIICQNF----------------ESTP----GITC-------SGSKP 72
            |...|.|....|..||....:|.:.                |..|    |..|       :|:|.
Zfish   268 CPFGKYGINCSKECSCRNGGLCDHITGQCQCMAGYSGHRCQEECPVGTYGPQCTLHCDCQNGAKC 332

  Fly    73 YYSKSKGSCQASADTYCDT--------SKICKGSGTGYIGD---------TINC----------A 110
            |:  ..|:|      .|||        .:.|.....|.|.|         ||:|          |
Zfish   333 YH--INGAC------LCDTGFKGHHCQDRFCPPGLYGLICDKYCPCNSTNTISCHPLTGECSCTA 389

  Fly   111 NW--YYCDADALLGKGTCNLGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDDANCHKYY 173
            .|  .||:.       ||..|.|.:.....|..:....|.:....|..||..|  .||       
Zfish   390 GWTGLYCNE-------TCPPGYYGEGCGVPCQCANGADCHSLTGACICAPGYT--GDD------- 438

  Fly   174 TCSSKSLVENTCENGLYYNVATGTCVRKKDVICENHPLPDE-VCGNKKLAVRNKFVSDMAT---- 233
             ||      .||.:||:....|..|.......|.  |:... :|......|....:....|    
Zfish   439 -CS------QTCPSGLFGTNCTSICHCHNQASCS--PIDGSCICKEGWQGVDCSILCSSGTWGLG 494

  Fly   234 CRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQER--QACMPRESQKCDYDRCDGRKDGFEVAEID 296
            |.....|.: |:.   .|||...|..::.:..||  |.|.....:....:|||       ....|
Zfish   495 CNQTCLCAN-GAA---CDPIDGSCTCSSGWRGERCQQPCPDGTYELECRERCD-------CNHAD 548

  Fly   297 GCHH---YIECVDGRETTPISCEDKYFDVVTQ-----NCSSTHLVY--GACS 338
            ||.|   ...|:.|  .|.|.|:    .:..|     |||.|....  |:||
Zfish   549 GCDHVSGLCRCLPG--WTGIHCD----SICPQGFWGSNCSMTCSCQNGGSCS 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 16/71 (23%)
CBM_14 154..204 CDD:279884 14/49 (29%)
megf11XP_009291879.1 EMI 32..98 CDD:311482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.