DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and Mur89F

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster


Alignment Length:321 Identity:72/321 - (22%)
Similarity:107/321 - (33%) Gaps:95/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GSCSESIICQNFESTPGITCSGSKPYYSKSKGSCQASADTYCDT------SKICKGSGTGYIGDT 106
            ||.|.|....| :||...|.|.|....:.::||..:|:.:...|      |:.||.:|. :|||.
  Fly  1153 GSSSGSNSSGN-QSTSSSTSSSSSSSNNNNQGSSSSSSSSSSSTSSKPNPSETCKVNGQ-FIGDR 1215

  Fly   107 INCANWYYC-DADALLGKGTCNLGMYFDQVSKSCVYSEDTVCAAKYEICD----------VAPVG 160
            .:||.:|.| |.|    :|.      |:.|..||  ...||..|:.:.|:          :||  
  Fly  1216 SDCAKFYRCVDND----RGG------FNMVPFSC--GPGTVWDAQMQACNHAWAVKECGGIAP-- 1266

  Fly   161 TPFRDDANCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICE------------------ 207
             |........:..|.|:....:.|..:.     .||.....:.|...                  
  Fly  1267 -PTTSTPTTSRPTTASTSRPSDQTSTSR-----PTGPPTTARPVTARPTTSSPTTASSSQTTSPV 1325

  Fly   208 -NHPLPDEVCGNKKLAVRNKFVSDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQACM 271
             ..|..|..|.::      .|::|...|..:|.|.....|...:.|.  ||.....::|:.|.|.
  Fly  1326 TQAPNTDGKCRSE------GFMADPNNCSKFYRCVRNNKGGFTSIPF--QCGAGTVWDQDLQTCN 1382

  Fly   272 PRESQKCDYDRCDGRKDGFEVAEIDGCHHYIECVDGRE-TTP-ISCEDKYFDVVTQNCSST 330
                                       |::..|..|.| ||| ..||.........:.|||
  Fly  1383 ---------------------------HNFNNCSTGTESTTPKPPCEPATNGTTATSTSST 1416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 17/51 (33%)
CBM_14 154..204 CDD:279884 9/59 (15%)
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884 20/67 (30%)
CBM_14 1336..1388 CDD:279884 13/86 (15%)
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.