DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and obst-F

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:286 Identity:47/286 - (16%)
Similarity:83/286 - (29%) Gaps:117/286 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ICRLFKDGTQLLKPGSCSESIICQNFESTPGITCSGSKPYYSKSKGSCQASADTYC--------- 89
            ||...::|..:..|..|:....|..   .|.:........:.:::..|....:|.|         
  Fly    42 ICLGRQEGDLVPHPLDCNGYFSCSR---VPTLLYCDQGLQFDENRAICDLPENTNCRPVATGTVE 103

  Fly    90 ------DTSKI----------------------------------CKGSGTGYIGDTINCANWYY 114
                  |.|::                                  |:..|..::....||..::.
  Fly   104 SANGLADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYFLPHPRNCGLYFI 168

  Fly   115 CDADALLGKGTCNLGMYFDQVSKSCVYSEDTVC-------------------------------- 147
            | |...|.:..|..|..::.....|..|:..:|                                
  Fly   169 C-AYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANSEGAVTVCY 232

  Fly   148 ---AAKY----------EICDVAPV--GTPFRDDAN-----------------CHKYYTCSSKSL 180
               :::|          ||.::.||  .:|.|.:||                 |.|||.|.....
  Fly   233 IVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCPSTKQSYMSHPEDCSKYYICIGGMP 297

  Fly   181 VENTCENGLYYNVATGTCVRKKDVIC 206
            |..:|..||:::..:|.|..:|:|.|
  Fly   298 VLTSCPKGLFWDQKSGFCEMEKNVKC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 11/50 (22%)
CBM_14 154..204 CDD:279884 18/68 (26%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 8/53 (15%)
CBM_14 156..198 CDD:279884 9/42 (21%)
CBM_14 272..321 CDD:279884 12/48 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.