DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and obst-H

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:266 Identity:63/266 - (23%)
Similarity:95/266 - (35%) Gaps:81/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SCQASADTYCDTSKICKGSGTG-YIGDTINCANWYYCDADALLGKGTCNLGMYFDQVSKSCVYSE 143
            |.:.:||.:.:    |.|...| ::....:|.::.||:.:..| ||.|..|.|||..:.:|..:.
  Fly    15 SSRINADHFDE----CDGMDDGAFVQSWESCQSYVYCEGEESL-KGDCEDGEYFDSEAGTCDIAA 74

  Fly   144 DTVC------------------------------------AAKYEICDVAPV---GTPFRDDA-- 167
            :..|                                    ..:.:|.::|||   ..|..||.  
  Fly    75 NVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQ 139

  Fly   168 --------NCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICENHPLPDEV-C------G 217
                    :|..||.|.....:|..|:|.||:|..||.|           ..||:| |      .
  Fly   140 VIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQC-----------DYPDKVQCAFEDPRS 193

  Fly   218 NKKLAVRNKFVSDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQACMPRESQKC-DYD 281
            :|.|....:|......|..:|||.   .|.    ...|||.....::.||::|:.....|| ...
  Fly   194 HKCLPHMTEFFPHPDNCNYFYYCI---KGF----LTLQQCPFYYGWDIERRSCVQIGVAKCYGNS 251

  Fly   282 RCDGRK 287
            |..|||
  Fly   252 RRIGRK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 15/51 (29%)
CBM_14 154..204 CDD:279884 19/62 (31%)
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 15/51 (29%)
CBM_14 142..184 CDD:279884 15/52 (29%)
ChtBD2 203..240 CDD:214696 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.