Sequence 1: | NP_648526.2 | Gene: | CG5883 / 39352 | FlyBaseID: | FBgn0036225 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034020.1 | Gene: | obst-H / 39681 | FlyBaseID: | FBgn0053983 | Length: | 269 | Species: | Drosophila melanogaster |
Alignment Length: | 266 | Identity: | 63/266 - (23%) |
---|---|---|---|
Similarity: | 95/266 - (35%) | Gaps: | 81/266 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 SCQASADTYCDTSKICKGSGTG-YIGDTINCANWYYCDADALLGKGTCNLGMYFDQVSKSCVYSE 143
Fly 144 DTVC------------------------------------AAKYEICDVAPV---GTPFRDDA-- 167
Fly 168 --------NCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICENHPLPDEV-C------G 217
Fly 218 NKKLAVRNKFVSDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQACMPRESQKC-DYD 281
Fly 282 RCDGRK 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5883 | NP_648526.2 | CBM_14 | 95..146 | CDD:279884 | 15/51 (29%) |
CBM_14 | 154..204 | CDD:279884 | 19/62 (31%) | ||
obst-H | NP_001034020.1 | CBM_14 | 26..77 | CDD:279884 | 15/51 (29%) |
CBM_14 | 142..184 | CDD:279884 | 15/52 (29%) | ||
ChtBD2 | 203..240 | CDD:214696 | 11/43 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D487374at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |