DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and CG10725

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:278 Identity:67/278 - (24%)
Similarity:97/278 - (34%) Gaps:48/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GSCQASADTYCDTSKICKGSGTGYIGDTINCANWYYCDADALLGKGTCNLGMYFDQVSKSCVYSE 143
            |||.|:.......|.:........:|   ||:.::.|..:..:.: .|....|||...:.||...
  Fly    15 GSCSAADGDVNVCSNVVNNLFVPQVG---NCSKYFLCMNEIAVPR-ECPTDYYFDARDQECVPLM 75

  Fly   144 DTVCAAKYEICDVAPVGTPFRDDANCHKYYTCSSKSLVENTCENGLYYNVATGTC-----VRKKD 203
            :..|...   |....:.: |..|..|.||..|...:.|...|.:||.||..|..|     |...|
  Fly    76 EVECIGS---CKNRGLSS-FCYDRTCTKYVLCFDGTPVIRQCSDGLQYNALTDRCDYPQYVDCVD 136

  Fly   204 VICENHPLPDEVCGNKKLAVRNKFVSDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQ 268
            .:|..:..||::.          |:...|.|..||.|.|   |:|..    |.|.....:|...|
  Fly   137 NLCSRNNNPDDIV----------FIPSKARCDKYYICMD---GLPQV----QNCTSGLQYNPSTQ 184

  Fly   269 ACMPRESQKCDYDRCDGRKDGF-----EVAEI----DGCHH---------YIECVDGRETTPISC 315
            :|.......|..:........|     .:|:|    :|.|.         |..|::||..|....
  Fly   185 SCDFPSKVNCTVESLQRNILPFARAPPRLADIECPSEGAHFIAHQKRQDAYYYCLNGRGVTLDCT 249

  Fly   316 EDKYFDVVTQNCSSTHLV 333
            ....||...:.|...|||
  Fly   250 PGLVFDAKREECREPHLV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 10/50 (20%)
CBM_14 154..204 CDD:279884 16/54 (30%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 9/41 (22%)
CBM_14 83..134 CDD:279884 16/51 (31%)
CBM_14 150..192 CDD:279884 14/48 (29%)
ChtBD2 216..264 CDD:214696 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.