DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and CG17826

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster


Alignment Length:455 Identity:96/455 - (21%)
Similarity:148/455 - (32%) Gaps:173/455 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YLNATDDICRLFKDGTQLLKPGSCSESIICQNFESTPG-----------ITCSGSKPYYSKSKGS 80
            |.|:..:|| :..||.  .:|.:|.:..|..|.:...|           :||... .|::.:...
  Fly    62 YWNSELNIC-VVDDGQ--CRPPTCVDGEITPNPDDCAGYLECVDGIIVILTCPDG-DYFNSTLNR 122

  Fly    81 CQASADTYCDTSKICKGSGT----GYIG-DTINCANWYYCDADALLGKGTCNLGMYFDQVSKSCV 140
            |..      ||..:|.|:||    |.:. |..|||.:..|.....:.| .|..|.||:.:.::||
  Fly   123 CVE------DTCGVCNGNGTTCTDGELKVDPTNCAGYLACSNGNWVSK-QCADGAYFNAILETCV 180

  Fly   141 YSEDTVC---------------------AAKY---------------EICDV-----------AP 158
            ..::.:|                     ..||               |:|||           ..
  Fly   181 QDDEGICVNCKEGSTKPLADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDVDNGQCNGNGTTCT 245

  Fly   159 VGTPFRDDANCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICEN------HPLPD---- 213
            .|....|..||..|..||:.:.|...|.:|.|:||...|||:..:.||.|      .||.|    
  Fly   246 DGELKVDPTNCAGYLACSNGNWVSKQCADGAYFNVTLETCVQDDEGICVNCKEGSTKPLADCTMY 310

  Fly   214 EVCGNKKLAVRNKFVSDMATC-RGYYY-------------CRDLGSGIPD----TDP-------- 252
            |:|...|...:        :| .|||:             |...|:...|    .||        
  Fly   311 EICSGGKYVTK--------SCDSGYYWNSQSEVCDVDNGQCNGNGTTCTDGELKVDPTNCAGYLA 367

  Fly   253 ------IYQQCDENNFFNQERQACMPRESQKC---------------DYDRCDGRK-------DG 289
                  :.:||.:..:||...:.|:..:...|               .|:.|.|.|       .|
  Fly   368 CSNGNWVSKQCADGAYFNATLETCVQDDEGICVNCKEGSTKPLADCTMYEICSGGKYVTKSCDSG 432

  Fly   290 F------EVAEID---------------------GCHHYIECVDGRETTPISCEDKYFDVVTQNC 327
            :      ||.::|                     .|..|:.|.:|...:....:..||:...:.|
  Fly   433 YYWNSQSEVCDVDNGQCNGNGTTCTDGELKVDPTNCAGYLACSNGNWVSKQCADGAYFNATLETC 497

  Fly   328  327
              Fly   498  497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 17/55 (31%)
CBM_14 154..204 CDD:279884 19/60 (32%)
CG17826NP_648528.1 CBM_14 36..74 CDD:279884 4/12 (33%)
ChtBD2 <89..124 CDD:214696 5/35 (14%)
CBM_14 145..184 CDD:279884 12/39 (31%)
CBM_14 251..290 CDD:279884 15/38 (39%)
CBM_14 357..396 CDD:279884 7/38 (18%)
CBM_14 463..502 CDD:279884 7/35 (20%)
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.