DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and CG5897

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:327 Identity:83/327 - (25%)
Similarity:128/327 - (39%) Gaps:34/327 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DDICRLFKDGTQLLKPGSCSESIICQNFESTPGITCSGSKPYYSKSKGSCQASADTYCDT--SKI 94
            :|.|:|:.....:..|..|.....||:.:.....:|:... .||...|:|:.::||.|.:  |:|
  Fly    26 EDKCKLWAGTGYIGDPSDCQAWGYCQDNKLIDRRSCTEGL-LYSFRDGTCKRASDTICHSQLSEI 89

  Fly    95 CKG-SGTGYIGDTINCANWYYC-DADALLGKGTCNLGMYFDQVSKSCVYSEDTVCAAKYEICDVA 157
            |.. ....|:.:..:|..:..| |.|.... |.|.:|..|....::|:  |:.....:..||...
  Fly    90 CASLEPWNYVANPADCRRFVKCADLDDPTW-GDCGVGQVFSNKKQTCL--EEVAGCPQDNICSHM 151

  Fly   158 PVGTPFRDDANCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICENH--------PLPD- 213
            ..|:...|..:|..||.|.:.......|..|.|:|..||.|.......|...        |..| 
  Fly   152 KDGSFVGDPKSCQIYYKCHNGFGTMLNCSVGRYFNRKTGNCQSWMPHYCSKDDEDNILTPPSTDH 216

  Fly   214 EVCGNKKLAVRN--KFVSDMATCRGYYYCR---DLGSGIPDTDPIYQQCDENNFFNQERQACMPR 273
            .:|.......|:  :.:.|:.||.|||.|.   |:|.        :..|.....|....|.|...
  Fly   217 NICSKYYQRDRDGVQLLPDLMTCYGYYSCTSQFDVGK--------WSSCPWGLHFEWWSQRCGSP 273

  Fly   274 ESQKCDYDRCDGRKDGFEVAEID-GCHHYIECVDGRETTPISC-ED-KYFDVVTQNCSSTHLVYG 335
            :...|.||||..|.. ..||.|: ||..:..|.|.|..:...| || .||:.:.:.|:..:..:.
  Fly   274 KDNSCSYDRCANRNQ-LMVATINTGCREFTICQDNRSKSSQKCPEDYPYFNELLRQCTDEYPNHR 337

  Fly   336 AC 337
            .|
  Fly   338 VC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 12/52 (23%)
CBM_14 154..204 CDD:279884 14/49 (29%)
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 1 1.000 - - FOG0005299
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.