DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and Muc68D

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:323 Identity:65/323 - (20%)
Similarity:104/323 - (32%) Gaps:95/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PGSCSESIICQNFESTP-GIT-CSGSKPYYSKSKGSCQASADTY------CDTSKICKGSGT--G 101
            ||....|    :.||.| |.| |:.:.|..|.:..........|      .:||.:...:||  |
  Fly  1246 PGDSGNS----SSESPPEGATPCTPNAPKKSTTSSYTAHPTPKYTTEGNKAETSTLKSPTGTTPG 1306

  Fly   102 YIGDTINCANWYYCDADALLGKGTCNLGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDD 166
            :..|..:|:|                                             .|.|...||.
  Fly  1307 HQEDRTDCSN---------------------------------------------MPNGIFLRDF 1326

  Fly   167 ANCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICENHPLPDEVCGNKK----------L 221
            .:|:|||.|.:...:...|...|::::....|.....|.|.....|:.|  .||          .
  Fly  1327 QSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVDCPLDEAPENV--TKKPSDTESTPDCK 1389

  Fly   222 AVRN-KFVSDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQACMPRESQKCDYDRCDG 285
            ::|| .:|.|..:|..:|.|.: |..||      :||.:...|:.:...|......:|..:....
  Fly  1390 SLRNGAYVRDPKSCSRFYVCAN-GRAIP------RQCPQGLHFDIKSNFCNYPILVQCSLEESQA 1447

  Fly   286 RKDGFEVAE-IDGC---------------HHYIECVDGRETTPISCEDKYFDVVTQNCSSTHL 332
            ...|..:|| :..|               :.|..|:.|:..........:||:.:|.|....|
  Fly  1448 DAHGALLAEGVPDCTKVKEDTRFGDVKQHNKYYVCLKGKAVLHYCSPGNWFDLRSQKCIDQRL 1510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 6/52 (12%)
CBM_14 154..204 CDD:279884 12/49 (24%)
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 15/96 (16%)
CBM_14 1388..1440 CDD:279884 14/58 (24%)
ChtBD2 1459..1505 CDD:214696 7/45 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.