DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and CG4835

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:467 Identity:91/467 - (19%)
Similarity:131/467 - (28%) Gaps:191/467 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VHQSIQTRYLNATDDI--------CRLFKDGTQLLKPGSCSESIICQNFESTPG----------- 64
            :|.|.....:..||.:        |:..||||.....|:|||.:||::.:...|           
  Fly   369 IHSSTTEEIVTTTDGLPSDVDPNDCKDEKDGTIFAYIGNCSEYLICKDNQVQMGHCPPNTLFNPD 433

  Fly    65 ---------ITCSGSK---------PYYSKSKGSCQASADTYCDT---SKICKGSGTG----YIG 104
                     :.|.|.:         |..:..|.:...:..|...|   .::|.|...|    |..
  Fly   434 LLVCDEPDDVVCLGDRTTTPIPTTIPTTTTEKTTPTTTTTTVATTLGPDQLCDGQELGASFSYPD 498

  Fly   105 DTINCANWYYCDADALLGKG-----TCNLGMYFDQVSKSC------------------------- 139
            |   |:.:|.|     ||.|     .|..|.|||..:..|                         
  Fly   499 D---CSKYYLC-----LGGGQWTLAPCIYGSYFDPSTGQCGPDVAPDACKPSQVTTTTTTTTTET 555

  Fly   140 ---------------VYSEDTVCAAKYEICDVAPVGTPFRDDANCHKYYTCSSKSLVENTCENGL 189
                           .....|..|.|..||.............||.||..|.|...:...|.:|.
  Fly   556 TTTERNTTPKSTATTTERTTTTVAPKTGICGGRNENENIAYPNNCTKYIVCVSPIPIAFFCPDGT 620

  Fly   190 YYNVATGTCVRKKD------------------------VICEN-----HPLPDEV-----CGNKK 220
            :::.....|:...|                        .:|.|     .|.||..     |.:..
  Fly   621 FFSSKLEKCIDDWDESDCEGDQSTTTLEPGYTRPPPEPTMCTNSSRDTFPYPDNCQWFIRCVDDY 685

  Fly   221 LAVRNKFVSDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQACMPRESQKCDYDR--- 282
            :     ::.|:..|..||            |||.::|.          |.:|.::.:.||..   
  Fly   686 I-----YMMDVCNCGEYY------------DPITEKCG----------ADVPSDACRWDYTSTTS 723

  Fly   283 --------------------CDGRKDGFEVAEIDGCHHYIECVDGRETTPISCE---------DK 318
                                ||..:||..||..:.|..||:| |........||         .|
  Fly   724 TTSEPTTTTAVTRPPPQKGPCDDVEDGALVAYPNDCSKYIQC-DRPIAVAFECEKGDEFSVELGK 787

  Fly   319 YFDVVTQNCSST 330
            ..|....|||.|
  Fly   788 CVDASLANCSIT 799

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 17/99 (17%)
CBM_14 154..204 CDD:279884 11/73 (15%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 12/50 (24%)
CBM_14 485..539 CDD:279884 17/61 (28%)
CBM_14 585..638 CDD:279884 11/52 (21%)
CBM_14 661..714 CDD:279884 16/79 (20%)
CBM_14 744..796 CDD:279884 15/52 (29%)
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.