DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and CG32302

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:342 Identity:77/342 - (22%)
Similarity:110/342 - (32%) Gaps:139/342 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GSCQASADTYCDTSKICKGSGTGYIGDTINCANWYYCDADA--------LLGKGTCNLGMYF--- 132
            ||..|: |..|...:|     .|::  .:||....||..||        :||   |.....|   
  Fly    17 GSAWAN-DNPCQDVRI-----PGFV--CMNCTTLGYCIRDATGSWETISMLG---CQSEYNFYCS 70

  Fly   133 DQVSKSCVYSEDTVCAAKYEICDVAPVGTPFR--------DDANCHKYYTCSSKSL-VENTCENG 188
            |:.:..|.:...         |.| |...||.        |..:|.:|:.||.:|: ....|.||
  Fly    71 DEGTFGCTFQSQ---------CQV-PKRGPFSCQQAGLFPDPYDCRRYHECSDQSVDTPRICSNG 125

  Fly   189 LYYNVATGTCVRKKDVICENHPLPDEVCGNKKLAVRNKFVSDMATC-------------RGYYYC 240
            ..|:..|||||.         |...|.|           :.:..||             |.:|.|
  Fly   126 AGYSTLTGTCVL---------PRESEQC-----------IQEQFTCSRSGQVGGWAPDNRYFYVC 170

  Fly   241 RDLGSGIPDTD----PIYQQCDENNFFN----------------QERQACMPRESQKC------- 278
                  :.||.    |:..:|.|...||                .|...||..:..:|       
  Fly   171 ------VNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESHTCMNNDRYQCPFRTSEI 229

  Fly   279 DYDRC-DGRKD------GFEV-----------------AEIDGC------HHYIECVDGRETTPI 313
            :|.:| ||..:      ||::                 .||..|      ..|..|:| .:....
  Fly   230 EYCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQCSDFEILSCPNVSTKDEYCICID-HQLQIY 293

  Fly   314 SCE-DKYFDVVTQNCSS 329
            ||. .:||:..|:.|.|
  Fly   294 SCPMGQYFNAETRKCQS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 13/61 (21%)
CBM_14 154..204 CDD:279884 20/58 (34%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.