DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and CG13806

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:313 Identity:72/313 - (23%)
Similarity:109/313 - (34%) Gaps:67/313 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RGLPSSLVLQ--ALLL-AVMVHQSIQTRYLNATDDICRLFKDGTQLLKPG----SCSESIIC--- 56
            |.|.|.|:|.  |||: |.:..:.||.|..|:    |    :|.|  .||    ||.....|   
  Fly     5 RILVSVLLLNLVALLMGATVTTRRIQPRETNS----C----EGRQ--SPGPICESCELLATCVRH 59

  Fly    57 -QNFESTPGITCSGSKPYYSKSK-GSCQASADTYCDTSKI-----CKGSGTGYIGDTINCANWYY 114
             ..:.:.|..:|..:..||..:: |||...... |....|     |  :..|...|..:|..::.
  Fly    60 SNGWVNIPVESCDVANGYYCNARLGSCTNETGP-CHPFGIEGNFQC--TSQGIFPDPYDCQKYHM 121

  Fly   115 C---DADALLGKGTCNLGMYFDQVSKSCVYS-EDTVCAAKYEICDVAPVGTPFRDDANCHKYYTC 175
            |   .|..:.....|.....||..:..|..: .|:||..:...|..|  |.......|.:.:|.|
  Fly   122 CYFVGATLVAAAVDCGNDKAFDATTGQCTLTLTDSVCLQRQYYCPNA--GHVAAWPTNPNIFYVC 184

  Fly   176 SS----------------------KSLVENTCENGLYYNVATGTCVRKKDVICENHPLPDEVCGN 218
            .|                      ::.|:..|.:|  .||...: .....||.|: |..|:....
  Fly   185 KSTVNQNLNDTIVIYPSLHRCNDGETFVDYVCRSG--SNVLPPS-TDDPSVIIED-PNDDDFSVL 245

  Fly   219 KKLAVRNKFVSDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQACM 271
            .........::|...||.||||..|...:...|     |....::..|..:|:
  Fly   246 PNTCQHVGLMADGNDCRKYYYCSALNGTLRHMD-----CPNGTYYRPELSSCV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 11/54 (20%)
CBM_14 154..204 CDD:279884 12/71 (17%)
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 10/52 (19%)
ChtBD2 247..293 CDD:214696 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.