DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and drpr

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:413 Identity:86/413 - (20%)
Similarity:121/413 - (29%) Gaps:182/413 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KDGTQLLKPGSCSESIICQN----------FESTPGIT---CSGSKPYYSKSKGSCQASADTYCD 90
            |.|.|      |.:...|||          ....||.|   |:...|..|...| ||.|.:.|  
  Fly   222 KHGAQ------CQQDCPCQNDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPG-CQESCECY-- 277

  Fly    91 TSKICKGS-----------GTGYIGD-----------------TINCANWYYCDADALLGKGT-- 125
                 ||:           ..||.|:                 |.:|||...||.    ..||  
  Fly   278 -----KGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDR----ANGTCI 333

  Fly   126 CNLGMYFDQVSKSCVYSEDTVCAA-KYEI-------CDVAPVGTPFRDDANCH------------ 170
            ||.|.    ....|.   :.:|.| ||.:       ||:........:..||.            
  Fly   334 CNPGW----TGAKCA---ERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTR 391

  Fly   171 -----KY-----YTCSSKSLVENTCENGLYYNVATGTCVRKKDVICE---NHPLPDEVCGNKKLA 222
                 :|     .||:        |:||...:...|||      :|.   ..|..:|.|      
  Fly   392 PCTFLRYGPNCELTCN--------CKNGAKCSPVNGTC------LCAPGWRGPTCEESC------ 436

  Fly   223 VRNKFVSDMA---TCRGYYYCRDLGSGIPDTDPIY-----------QQCDENNFFN--------Q 265
            ....|..|.|   .|:....|.      |:|....           :.||.|:|..        .
  Fly   437 EPGTFGQDCALRCDCQNGAKCE------PETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCH 495

  Fly   266 ERQACMPRE----------SQKCDYDRCDGRKDGFEVAEIDGC--HHYIEC--VDGR-------- 308
            ...||.|:.          .::|: .:||..|.|.:.|:...|  ::.:.|  .:||        
  Fly   496 NNAACNPQNGSCTCAAGWTGERCE-RKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWG 559

  Fly   309 ----ETTPISCEDKYFDVVTQNC 327
                ||   :|...|:.   :||
  Fly   560 GVHCET---NCRSGYYG---ENC 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 17/80 (21%)
CBM_14 154..204 CDD:279884 13/71 (18%)
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 7/51 (14%)
DSL <479..518 CDD:302925 7/38 (18%)
DSL <567..606 CDD:302925 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.