DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and obst-E

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:206 Identity:47/206 - (22%)
Similarity:69/206 - (33%) Gaps:46/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VGTP--------FRDDANCHKYYTCSSKSLVENTCENGLYYN---VATGTCVRKKDVICENHPLP 212
            :|:|        |.....|..|..|...:.||..|.:||.::   .|||.|.......|:.....
  Fly    20 LGSPECPTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYSTCKERARL 84

  Fly   213 DEVCGNKKLAVRNKFV--SDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQERQAC-MPRE 274
            ....|.::...:..|.  .|...| |.|  |:...|:..    ..:|.|...||:|...| .|..
  Fly    85 QPANGTEECPRQFGFYPNGDATKC-GVY--RNCAHGVAS----LTKCPEGLAFNEETYQCDWPDL 142

  Fly   275 SQKCDYDRCDG-------RKDGFEVAEID--------------GCHHYIECVDGRETTPISCEDK 318
            .:.|:.:...|       ..|....|.:|              .|..|..||:|.... .:| .|
  Fly   143 VESCNAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRL-YNC-GK 205

  Fly   319 Y--FDVVTQNC 327
            |  |:..|:.|
  Fly   206 YLAFNSQTKLC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884
CBM_14 154..204 CDD:279884 15/55 (27%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 10/41 (24%)
CBM_14 95..146 CDD:307643 14/57 (25%)
CBM_14 180..225 CDD:307643 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.