DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and CG34324

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:161 Identity:35/161 - (21%)
Similarity:49/161 - (30%) Gaps:58/161 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PGSCSESIICQNFESTPGIT--CSGSKPYYSKSKGSCQASADTYCDTSKICKGSGTGYIGDTINC 109
            |..|:.:..|   .:||..|  |:.:||        |   ..|.|.|.   |....|.|.|    
  Fly   142 PPPCTRTPPC---TTTPPCTPPCTTTKP--------C---TTTVCTTP---KSDNAGPIVD---- 185

  Fly   110 ANWYYCDAD-------ALLGKGTCNLGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDDA 167
            .|....|.|       .|:.:..|.             ..||               ||...|..
  Fly   186 GNEEQPDIDNPVAIAQVLISRHDCR-------------GQED---------------GTFLADVR 222

  Fly   168 NCHKYYTCSSKSLVENTCENGLYYNVATGTC 198
            :|.:||.|:.:......|.||.:::.....|
  Fly   223 HCRRYYVCNRQRSKRQNCPNGYWFDRELKAC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 11/57 (19%)
CBM_14 154..204 CDD:279884 11/45 (24%)
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.