DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and CG33263

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_996072.1 Gene:CG33263 / 2768952 FlyBaseID:FBgn0053263 Length:227 Species:Drosophila melanogaster


Alignment Length:216 Identity:44/216 - (20%)
Similarity:68/216 - (31%) Gaps:71/216 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 CDVAPVGTPFRDDANCHKYYTCSSKSLVENTCENGLYYNVAT--------GTCVRKKDVICENHP 210
            |..||:.|......:|..|..|:.:....::|....|::..|        |.|:|..|.: :...
  Fly    28 CANAPLDTFVMAIEDCASYIYCNGEDSFRDSCPESTYFDDRTQECAFDDEGVCLRNSDSV-QTEE 91

  Fly   211 LPD-EVCGNKKLAVRNKFVSDMATCRGYYYCRDLGSGIPDTDPI------YQ---QCDENNFFNQ 265
            .|| :..|.::                        |||.:|.|:      |.   ..|.:.|  |
  Fly    92 QPDKQTTGEEQ------------------------SGIEETTPVPTPPSDYASTGSADSSTF--Q 130

  Fly   266 ERQACMPRE-----------------------SQKCDYDRCDGRKDGFEVAEIDGCHHYIECVDG 307
            ......|.|                       |...:...||...|| :......|.:|..|:.|
  Fly   131 ADSTTTPTESIPSVTEPPTTSATPSSPSAKPSSPAQERPHCDISGDG-DHPHPQRCEYYYRCLSG 194

  Fly   308 RETTPISCEDKY-FDVVTQNC 327
             ..|.:.|..|| :|..|:.|
  Fly   195 -YLTIVRCPYKYGWDFPTKQC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884
CBM_14 154..204 CDD:279884 13/57 (23%)
CG33263NP_996072.1 CBM_14 28..79 CDD:279884 10/50 (20%)
CBM_14 171..222 CDD:279884 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.