DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and ule-1

DIOPT Version :10

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_490942.1 Gene:ule-1 / 171778 WormBaseID:WBGene00021005 Length:235 Species:Caenorhabditis elegans


Alignment Length:110 Identity:28/110 - (25%)
Similarity:43/110 - (39%) Gaps:27/110 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DGTQLLKPGSCSESIICQ----------NFESTPGITCSGSKPYYSKSKGSCQASADTYCDTSKI 94
            |||:.:|.....:::..|          .:..|.....:.:.|||    |:|:.||         
 Worm   109 DGTEYIKRYCQPDAVFVQRENMCVAIQTTYRPTRTWPTTTTTPYY----GACKESA--------- 160

  Fly    95 CKGSGTGYIGDTINCANWYYCDADALLGKGTCNLGMYFDQVSKSC 139
               ...||..|..||.|:|.| |..|..:.:|..|..:||...:|
 Worm   161 ---GHDGYKPDVYNCKNFYQC-ASGLWTQRSCGEGTIWDQHKLTC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:426342 15/45 (33%)
CBM_14 154..204 CDD:426342
ule-1NP_490942.1 ChtBD2 <30..61 CDD:214696
ChtBD2 159..204 CDD:214696 17/56 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.