DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and CG43218

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001246864.1 Gene:CG43218 / 12798438 FlyBaseID:FBgn0262854 Length:182 Species:Drosophila melanogaster


Alignment Length:194 Identity:44/194 - (22%)
Similarity:63/194 - (32%) Gaps:58/194 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDDANCHKYYTCSSKSLVENTCENGLYYN 192
            |..||.. .:|..|:.|.:|     ||....|.....|..:|..||.|...|..:..|..||.::
  Fly    14 LSDYFTS-GQSYTYNADEIC-----ICSGHLVNDLVPDCEDCSGYYICGDGSYEKVKCPQGLIFD 72

  Fly   193 VATGTCV----RKKDVICENH--------------------PLPDEVCGNK-KLAVRNKFVSDMA 232
            :|..|||    .:.|..|..:                    |.|...|.|. ...::.|.:....
  Fly    73 IALNTCVLGQCPRFDGTCSANSTVPPPVTTTTTTAAPETIPPTPSGPCDNDVTCQLQEKSIPHPT 137

  Fly   233 TCRGYYYCRD----LGSGIPDTDPIYQQCDENNFFNQERQACMPRESQKCDYD----RCDGRKD 288
            .||.:|.|..    ||           .|:...:|:        ||...|:|.    .|...:|
  Fly   138 HCRNFYTCYGKCAVLG-----------LCELGKWFD--------REGNVCNYSHKVTNCPANQD 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 6/17 (35%)
CBM_14 154..204 CDD:279884 15/53 (28%)
CG43218NP_001246864.1 CBM_14 34..79 CDD:279884 13/44 (30%)
CBM_14 133..177 CDD:279884 12/62 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.