DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and LOC110437948

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_021322240.1 Gene:LOC110437948 / 110437948 -ID:- Length:195 Species:Danio rerio


Alignment Length:240 Identity:49/240 - (20%)
Similarity:71/240 - (29%) Gaps:84/240 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ICQNFESTPGITCSGSKPYYSKSKGSCQASAD----------TYCD---TSKICKGSGTGY-IGD 105
            :|.||          ::.:|...|.......|          .||.   |..:...|||.. :..
Zfish     6 LCHNF----------TQRFYCTEKAESPTPIDGITGHVCPEGHYCPPGATRPVPCHSGTFVTVPQ 60

  Fly   106 TINC----ANWYYCDADALLGKGTCNLGMYFDQVS----KSC---VYSEDT--VCAAKYEICDVA 157
            ...|    |.||..|...||    |..|.|..:.:    :.|   .||.|:  :..::...||..
Zfish    61 ASQCWACTAGWYCADGGRLL----CPAGFYCPEGTGYDIRPCPAGTYSPDSGLISLSECRACDGG 121

  Fly   158 PVGTPFRDDANCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICENHPLPDEVCGNKKLA 222
                         .|.:..:.|.|...|..|.|  .|.|..          .|.|         .
Zfish   122 -------------HYCSLQNSSSVTGQCSEGYY--CAQGNI----------SPQP---------Y 152

  Fly   223 VRNKFVSDMATCRGYYYCRDLGSGIPDTDPIYQQCDENNFFNQER 267
            .:|..|..:  |...::|.. |:..|      |.|.|..|.|:.:
Zfish   153 TQNTGVGGL--CPVGHFCPQ-GTAQP------QPCPEGTFSNRTK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 17/64 (27%)
CBM_14 154..204 CDD:279884 10/49 (20%)
LOC110437948XP_021322240.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.